KEGG   Homo sapiens (human): 846Help
Entry
846               CDS       T01001                                 

Gene name
CASR, CAR, EIG8, FHH, FIH, GPRC2A, HHC, HHC1, HYPOC1, NSHPT, PCAR1, hCasR
Definition
(RefSeq) calcium sensing receptor
  KO
K04612  calcium-sensing receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Network
nt06318  CaSR-PTH signaling
  Element
N00291  CaSR-PTH signaling pathway
N00292  Mutation-inactivated CASR to CasR-PTH signaling pathway
Disease
H00239  Bartter syndrome
H00245  Calcium sensing receptor (CASR) related disease
H00246  Primary hyperparathyroidism
H00808  Idiopathic generalized epilepsies
H01558  Parathyroid carcinoma
H02026  Familial hypocalciuric hypercalcemia
H02030  Neonatal hyperparathyroidism
Drug target
Cinacalcet (DG00513): D03504 D03505
Etelcalcetide (DG01856): D10676 D10677
Evocalcet: D11063
Ronacaleret hydrochloride: D08991
Tecalcet hydrochloride: D06020
Upacicalcet sodium hydrate: D11564
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    846 (CASR)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    846 (CASR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    846 (CASR)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Calcium-sensing
   846 (CASR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 Ephrin_rec_like CCSAP
Motif
Other DBs
NCBI-GeneID: 846
NCBI-ProteinID: NP_000379
OMIM: 601199
HGNC: 1514
Ensembl: ENSG00000036828
Pharos: P41180(Tclin)
UniProt: P41180
LinkDB All DBs
Structure
PDB: 

Position
3q13.33-q21.1
AA seq 1078 aa AA seqDB search
MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQP
RCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHEPLLPLQCGE
TDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGSTVTENVVNS
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggcattttatagctgctgctgggtcctcttggcactcacctggcacacctctgcctac
gggccagaccagcgagcccaaaagaagggggacattatccttggggggctctttcctatt
cattttggagtagcagctaaagatcaagatctcaaatcaaggccggagtctgtggaatgt
atcaggtataatttccgtgggtttcgctggttacaggctatgatatttgccatagaggag
ataaacagcagcccagcccttcttcccaacttgacgctgggatacaggatatttgacact
tgcaacaccgtttctaaggccttggaagccaccctgagttttgttgctcaaaacaaaatt
gattctttgaaccttgatgagttctgcaactgctcagagcacattccctctacgattgct
gtggtgggagcaactggctcaggcgtctccacggcagtggcaaatctgctggggctcttc
tacattccccaggtcagttatgcctcctccagcagactcctcagcaacaagaatcaattc
aagtctttcctccgaaccatccccaatgatgagcaccaggccactgccatggcagacatc
atcgagtatttccgctggaactgggtgggcacaattgcagctgatgacgactatgggcgg
ccggggattgagaaattccgagaggaagctgaggaaagggatatctgcatcgacttcagt
gaactcatctcccagtactctgatgaggaagagatccagcatgtggtagaggtgattcaa
aattccacggccaaagtcatcgtggttttctccagtggcccagatcttgagcccctcatc
aaggagattgtccggcgcaatatcacgggcaagatctggctggccagcgaggcctgggcc
agctcctccctgatcgccatgcctcagtacttccacgtggttggcggcaccattggattc
gctctgaaggctgggcagatcccaggcttccgggaattcctgaagaaggtccatcccagg
aagtctgtccacaatggttttgccaaggagttttgggaagaaacatttaactgccacctc
caagaaggtgcaaaaggacctttacctgtggacacctttctgagaggtcacgaagaaagt
ggcgacaggtttagcaacagctcgacagccttccgacccctctgtacaggggatgagaac
atcagcagtgtcgagaccccttacatagattacacgcatttacggatatcctacaatgtg
tacttagcagtctactccattgcccacgccttgcaagatatatatacctgcttacctggg
agagggctcttcaccaatggctcctgtgcagacatcaagaaagttgaggcgtggcaggtc
ctgaagcacctacggcatctaaactttacaaacaatatgggggagcaggtgacctttgat
gagtgtggtgacctggtggggaactattccatcatcaactggcacctctccccagaggat
ggctccatcgtgtttaaggaagtcgggtattacaacgtctatgccaagaagggagaaaga
ctcttcatcaacgaggagaaaatcctgtggagtgggttctccagggaggtgcccttctcc
aactgcagccgagactgcctggcagggaccaggaaagggatcattgagggggagcccacc
tgctgctttgagtgtgtggagtgtcctgatggggagtatagtgatgagacagatgccagt
gcctgtaacaagtgcccagatgacttctggtccaatgagaaccacacctcctgcattgcc
aaggagatcgagtttctgtcgtggacggagccctttgggatcgcactcaccctctttgcc
gtgctgggcattttcctgacagcctttgtgctgggtgtgtttatcaagttccgcaacaca
cccattgtcaaggccaccaaccgagagctctcctacctcctcctcttctccctgctctgc
tgcttctccagctccctgttcttcatcggggagccccaggactggacgtgccgcctgcgc
cagccggcctttggcatcagcttcgtgctctgcatctcatgcatcctggtgaaaaccaac
cgtgtcctcctggtgtttgaggccaagatccccaccagcttccaccgcaagtggtggggg
ctcaacctgcagttcctgctggttttcctctgcaccttcatgcagattgtcatctgtgtg
atctggctctacaccgcgcccccgtcaagctaccgcaaccaggagctggaggatgagatc
atcttcatcacgtgccacgagggctccctcatggccctgggcttcctgatcggctacacc
tgcctgctggctgccatctgcttcttctttgccttcaagtcccggaagctgccggagaac
ttcaatgaagccaagttcatcaccttcagcatgctcatcttcttcatcgtctggatctcc
ttcattccagcctatgccagcacctatggcaagtttgtctctgccgtagaggtgattgcc
atcctggcagccagctttggcttgctggcgtgcatcttcttcaacaagatctacatcatt
ctcttcaagccatcccgcaacaccatcgaggaggtgcgttgcagcaccgcagctcacgct
ttcaaggtggctgcccgggccacgctgcgccgcagcaacgtctcccgcaagcggtccagc
agccttggaggctccacgggatccaccccctcctcctccatcagcagcaagagcaacagc
gaagacccattcccacagcccgagaggcagaagcagcagcagccgctggccctaacccag
caagagcagcagcagcagcccctgaccctcccacagcagcaacgatctcagcagcagccc
agatgcaagcagaaggtcatctttggcagcggcacggtcaccttctcactgagctttgat
gagcctcagaagaacgccatggcccacaggaattctacgcaccagaactccctggaggcc
cagaaaagcagcgatacgctgacccgacacgagccattactcccgctgcagtgcggggaa
acggacttagatctgaccgtccaggaaacaggtctgcaaggacctgtgggtggagaccag
cggccagaggtggaggaccctgaagagttgtccccagcacttgtagtgtccagttcacag
agctttgtcatcagtggtggaggcagcactgttacagaaaacgtagtgaattcataa

DBGET integrated database retrieval system