KEGG   Homo sapiens (human): 84693
Entry
84693             CDS       T01001                                 

Gene name
MCEE, GLOD2, MCE
Definition
(RefSeq) methylmalonyl-CoA epimerase
  KO
K05606  methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa00640  Propanoate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00842  Propanoyl-CoA metabolism
N00843  MMUT deficiency in propanoyl-CoA metabolism
N00844  MCEE deficiency in propanoyl-CoA metabolism
Disease
H00174  Methylmalonic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    84693 (MCEE)
   00640 Propanoate metabolism
    84693 (MCEE)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    84693 (MCEE)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     84693 (MCEE)
SSDB
Motif
Pfam: Glyoxalase_4 Glyoxalase Glyoxalase_3 Glyoxalase_2 Glyoxalase_6
Other DBs
NCBI-GeneID: 84693
NCBI-ProteinID: NP_115990
OMIM: 608419
HGNC: 16732
Ensembl: ENSG00000124370
Vega: OTTHUMG00000129709
Pharos: Q96PE7(Tbio)
UniProt: Q96PE7
LinkDB
Structure
PDB: 
3RMU 6QH4

Position
2p13.3
AA seq 176 aa
MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcgcgggtgctgaaggctgcagccgcgaatgccgtagggcttttttccagacttcaa
gctcccattccaacagtaagagcttcttccacatcacagcccttggatcaagtgacaggt
tctgtgtggaacctgggtcgactcaaccatgtagccatagcagtgccagatttggaaaag
gctgcagcattttataagaatattctgggggcccaggtaagtgaagcggtccctcttcct
gaacatggagtatctgttgtttttgtcaacctgggaaataccaagatggaactgcttcat
ccattgggacgtgacagtccaattgcaggttttctgcagaaaaacaaggctggaggaatg
catcacatctgcatcgaggtggataatattaatgcagctgtgatggatttgaaaaaaaag
aagatccgcagtctaagtgaagaggtcaaaataggagcacatggaaaaccagtgattttt
ctccatcctaaagactgtggtggagtccttgtggaactggagcaagcttga

DBGET integrated database retrieval system