KEGG   Homo sapiens (human): 84720Help
Entry
84720             CDS       T01001                                 

Gene name
PIGO, HPMRS2
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class O
  KO
K05288  GPI ethanolamine phosphate transferase 3 subunit O [EC:2.7.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06018  GPI-anchor biosynthesis
  Element
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
Disease
H01488  Hyperphosphatasia with mental retardation syndrome
H01489  Inherited glycosylphosphatidylinositol deficiencies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    84720 (PIGO)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.-  Transferring phosphorus-containing groups
    2.7.-.-  
     84720 (PIGO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-GeneID: 84720
NCBI-ProteinID: NP_116023
OMIM: 614730
HGNC: 23215
Ensembl: ENSG00000165282
Vega: OTTHUMG00000019854
Pharos: Q8TEQ8(Tbio)
UniProt: Q8TEQ8
LinkDB All DBs
Position
9p13.3
AA seq 1089 aa AA seqDB search
MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGA
CWMASRFSRVVLVLIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARL
YRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNLIKQLTSAGRRVVFMGDD
TWKDLFPGAFSKAFFFPSFNVRDLDTVDNGILEHLYPTMDSGEWDVLIAHFLGVDHCGHK
HGPHHPEMAKKLSQMDQVIQGLVERLENDTLLVVAGDHGMTTNGDHGGDSELEVSAALFL
YSPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIPFGNIGEVMAELFSGGEDSQPHSSA
LAQASALHLNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAEAT
LPTVIAELQQFLRGARAMCIESWARFSLVRMAGGTALLAASCFICLLASQWAISPGFPFC
PLLLTPVAWGLVGAIAYAGLLGTIELKLDLVLLGAVAAVSSFLPFLWKAWAGWGSKRPLA
TLFPIPGPVLLLLLFRLAVFFSDSFVVAEARATPFLLGSFILLLVVQLHWEGQLLPPKLL
TMPRLGTSATTNPPRHNGAYALRLGIGLLLCTRLAGLFHRCPEETPVCHSSPWLSPLASM
VGGRAKNLWYGACVAALVALLAAVRLWLRRYGNLKSPEPPMLFVRWGLPLMALGTAAYWA
LASGADEAPPRLRVLVSGASMVLPRAVAGLAASGLALLLWKPVTVLVKAGAGAPRTRTVL
TPFSGPPTSQADLDYVVPQIYRHMQEEFRGRLERTKSQGPLTVAAYQLGSVYSAAMVTAL
TLLAFPLLLLHAERISLVFLLLFLQSFLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMAT
QTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLW
PFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFIL
GIQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVSSWF
RQLFLAQQR
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagcctcagtgttgctcttcctggcctgggtctgcttcctcttctacgctggc
attgccctcttcaccagtggcttcctgctcacccgtttggagctcaccaaccatagcagc
tgccaagagcccccaggccctgggtccctgccatgggggagccaagggaaacctggggcc
tgctggatggcttcccgattttcgcgggttgtgttggtgctgatagatgctctgcgattt
gacttcgcccagccccagcattcacacgtgcctagagagcctcctgtctccctacccttc
ctgggcaaactaagctccttgcagaggatcctggagattcagccccaccatgcccggctc
taccgatctcaggttgaccctcctaccaccaccatgcagcgcctcaaggccctcaccact
ggctcactgcctacctttattgatgctggtagtaacttcgccagccacgccatagtggaa
gacaatctcattaagcagctcaccagtgcaggaaggcgtgtagtcttcatgggagatgat
acctggaaagaccttttccctggtgctttctccaaagctttcttcttcccatccttcaat
gtcagagacctagacacagtggacaatggcatcctggaacacctctaccccaccatggac
agtggtgaatgggacgtgctgattgctcacttcctgggtgtggaccactgtggccacaag
catggccctcaccaccctgaaatggccaagaaacttagccagatggaccaggtgatccag
ggacttgtggagcgtctggagaatgacacactgctggtagtggctggggaccatgggatg
accacaaatggagaccatggaggggacagtgagctggaggtctcagctgctctctttctg
tatagccccacagcagtcttccccagcaccccaccagaggagccagaggtgattcctcaa
gttagccttgtgcccacgctggccctgctgctgggcctgcccatcccatttgggaatatc
ggggaagtgatggctgagctattctcagggggtgaggactcccagccccactcctctgct
ttagcccaagcctcagctctccatctcaatgctcagcaggtgtcccgatttcttcatacc
tactcagctgctactcaggaccttcaagctaaggagcttcatcagctgcagaacctcttc
tccaaggcctctgctgactaccagtggcttctccagagccccaagggggctgaggcgaca
ctgccgactgtgattgctgagctgcagcagttcctgcggggagctcgggccatgtgcatc
gagtcttgggctcgtttctctctggtccgcatggcggggggtactgctctcttggctgct
tcctgctttatctgcctgctggcatctcagtgggcaatatccccaggctttccattctgc
cctctactcctgacacctgtggcctggggcctggttggggccatagcgtatgctggactc
ctgggaactattgagctgaagctagatctagtgcttctaggggctgtggctgcagtgagc
tcattcctcccttttctgtggaaagcctgggctggctgggggtccaagaggcccctggca
accctgtttcccatccctgggcccgtcctgttactcctgctgtttcgcttggctgtgttc
ttctctgatagttttgttgtagctgaggccagggccacccccttccttttgggctcattc
atcctgctcctggttgtccagcttcactgggagggccagctgcttccacctaagctactc
acaatgccccgccttggcacttcagccacaacaaaccccccacggcacaatggtgcatat
gccctgaggcttggaattgggttgcttttatgtacaaggctagctgggctttttcatcgt
tgccctgaagagacacctgtttgccactcctctccctggctgagtcctctggcatccatg
gtgggtggtcgagccaagaatttgtggtatggagcttgtgtggcggcgctggtggccctg
ttagctgccgtgcgcttgtggcttcgccgctatggtaatctcaagagccccgagccaccc
atgctctttgtgcgctggggactgcccctaatggcattgggtactgctgcctactgggca
ttggcgtcgggggcagatgaggctcccccccgtctccgggtcctggtctctggggcatcc
atggtgctgcctcgggctgtagcagggctggctgcttcagggctcgcgctgctgctctgg
aagcctgtgacagtgctggtgaaggctggggcaggcgctccaaggaccaggactgtcctc
actcccttctcaggcccccccacttctcaagctgacttggattatgtggtccctcaaatc
taccgacacatgcaggaggagttccggggccggttagagaggaccaaatctcagggtccc
ctgactgtggctgcttatcagttggggagtgtctactcagctgctatggtcacagccctc
accctgttggccttcccacttctgctgttgcatgcggagcgcatcagccttgtgttcctg
cttctgtttctgcagagcttccttctcctacatctgcttgctgctgggatacccgtcacc
acccctggtccttttactgtgccatggcaggcagtctcggcttgggccctcatggccaca
cagaccttctactccacaggccaccagcctgtctttccagccatccattggcatgcagcc
ttcgtgggattcccagagggtcatggctcctgtacttggctgcctgctttgctagtggga
gccaacacctttgcctcccacctcctctttgcagtaggttgcccactgctcctgctctgg
cctttcctgtgtgagagtcaagggctgcggaagagacagcagcccccagggaatgaagct
gatgccagagtcagacccgaggaggaagaggagccactgatggagatgcggctccgggat
gcgcctcagcacttctatgcagcactgctgcagctgggcctcaagtacctctttatcctt
ggtattcagattctggcctgtgccttggcagcctccatccttcgcaggcatctcatggtc
tggaaagtgtttgcccctaagttcatatttgaggctgtgggcttcattgtgagcagcgtg
ggacttctcctgggcatagctttggtgatgagagtggatggtgctgtgagctcctggttc
aggcagctatttctggcccagcagaggtag

KEGG   Homo sapiens (human): 5281Help
Entry
5281              CDS       T01001                                 

Gene name
PIGF
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class F
  KO
K05287  GPI ethanolamine phosphate transferase 2/3 subunit F
Organism
hsa  Homo sapiens (human)
Pathway
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06018  GPI-anchor biosynthesis
  Element
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    5281 (PIGF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIG-F
Motif
Other DBs
NCBI-GeneID: 5281
NCBI-ProteinID: NP_002634
OMIM: 600153
HGNC: 8962
Ensembl: ENSG00000151665
Vega: OTTHUMG00000128816
Pharos: Q07326(Tbio)
UniProt: Q07326 Q6IB04
LinkDB All DBs
Position
2p21
AA seq 219 aa AA seqDB search
MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGFVTAVNLVLYL
VVKPNTSSKRSSLSHKVTGFLKCCIYFLMSCFSFHVIFVLYGAPLIELALETFLFAVILS
TFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFVGAWLGALPIPLDWERP
WQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataacgatatcaagagactactgtatacccatcttttatgcatattttcaatt
atcctaagtgtcttcattccatcactcttcttggagaacttctcaatattggaaacacac
ttgacatggttgtgcatctgttctggttttgtaactgctgtcaatctagtactatattta
gtagtgaaaccaaatacatcctctaaaagaagttcattatcacacaaggtaactggattt
ttgaaatgctgtatctactttcttatgtcttgtttctcctttcatgtaatttttgttctg
tatggagcaccactgatagagttggcattggaaacatttttatttgcagttattttgtct
acttttactactgtgccttgcttatgtttgttaggaccaaacctcaaagcatggctaaga
gtgttcagtagaaatggagttacatccatatgggagaatagtctccagatcactacaatt
tctagctttgtaggagcatggcttggagcacttcctattccactggattgggaaagacca
tggcaggtatggcccatctcctgtacgcttggagcgacctttggctacgtggctggcctt
gttatttcaccactctggatatactggaatagaaagcaacttacatacaagaacaattaa

DBGET integrated database retrieval system