KEGG   Homo sapiens (human): 84787
Entry
84787             CDS       T01001                                 

Gene name
KMT5C, SUV420H2, Suv4-20h2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    84787 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84787 (KMT5C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     84787 (KMT5C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     84787 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 84787
NCBI-ProteinID: NP_116090
OMIM: 613198
HGNC: 28405
Ensembl: ENSG00000133247
Vega: OTTHUMG00000150483
Pharos: Q86Y97(Tdark)
UniProt: Q86Y97
LinkDB
Structure
PDB: 
3RQ4

Position
19q13.42
AA seq 462 aa
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggggcccgacagagtgacagcacgagaactgtgcgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
cccctgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggacggcccgctacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttaccatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcattgcagagctgcgggaggcagatgaggggctgctgagggccggtgagaatgacttc
agcatcatgtactcaacccgcaagcggagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaacgcagcctgc
gtgaaggtgctccgggacattgagcctggggacgaggtgacatgcttctacggcgagggc
ttcttcggcgagaagaatgagcactgtgaatgccacacctgtgagaggaaaggtgaagga
gctttccgaaccaggcctagggagcccgcgttgccaccacggcccctggacaagtaccag
ctgcgtgagaccaagcggcggctgcagcaaggcctggacagtggcagccgacagggcctg
ctgggccctcgggcctgcgtgcacccatccccgctgcgccgggacccattctgcgccgcc
tgccagcccctgcgcctgccagcctgcagcgcccgcccagacacctcacccctctggctc
cagtggctgcctcagccccagccccgagtgcggccccggaagcgccgacgcccccggccc
cggagggccccagtgctctccacccaccacgctgcccgcgtctccctgcaccgatgggga
ggctgtggcccccactgccgcctgcgaggagaggccctggtggccctgggccagcccccc
cacgcccgctgggcccctcagcaggactggcactgggcccggcgctatgggctgccttac
gtggtgcgtgtggaccttcgtcgcctggccccagccccaccagctaccccagcccctgct
gggaccccaggccccatcctgatcccgaagcaggccctcgccttcgcccccttctcccca
cccaagcgcctacggctggtggtcagccacggctccatcgacctggatgtcggcggtgaa
gagctgtga

DBGET integrated database retrieval system