KEGG   Homo sapiens (human): 84839
Entry
84839             CDS       T01001                                 

Gene name
RAX2, ARMD6, CORD11, QRX, RAXL1
Definition
(RefSeq) retina and anterior neural fold homeobox 2
  KO
K09333  retina and anterior neural fold homeobox-like protein
Organism
hsa  Homo sapiens (human)
Disease
H00481  Cone-rod dystrophy and cone dystrophy
H00821  Age-related macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    84839 (RAX2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    84839 (RAX2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 84839
NCBI-ProteinID: NP_001306003
OMIM: 610362
HGNC: 18286
Ensembl: ENSG00000173976
Vega: OTTHUMG00000171148
Pharos: Q96IS3(Tbio)
UniProt: Q96IS3
LinkDB
Position
19p13.3
AA seq 184 aa
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREEL
AAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEP
WLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRA
WPPA
NT seq 555 nt   +upstreamnt  +downstreamnt
atgttcctgagcccgggcgaggggccggcaaccgagggtgggggtctggggccgggcgag
gaggcccccaagaagaagcaccggaggaaccgcaccaccttcaccacctaccagctgcac
cagctggagcgggcgttcgaggcctctcactacccggatgtgtacagccgtgaggagctg
gcagccaaggtgcacctacctgaggtgcgcgtgcaggtgtggttccagaaccgccgggcc
aagtggcgccgccaggagcggctggagtcaggctcgggtgccgtggcagctccgagactc
cccgaggccccagcgctgccgttcgcccgccccccggccatgtcgctgcccctggagccc
tggttgggccccggaccgccggccgtgccaggcctcccccgcctcctgggcccgggcccg
gggctgcaagcgtccttcgggcctcatgcctttgctcccaccttcgcagatggcttcgcc
ctggaggaggcgtccctgcggctgctggccaaggaacatgcacaggctctggacagggcc
tggccgccagcctga

DBGET integrated database retrieval system