KEGG   Homo sapiens (human): 84930Help
Entry
84930             CDS       T01001                                 

Gene name
MASTL, GREATWALL, GW, GWL, MAST-L, THC2
Definition
(RefSeq) microtubule associated serine/threonine kinase like
  KO
K16309  serine/threonine-protein kinase greatwall [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00978  Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    84930 (MASTL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     84930 (MASTL)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  MAST family [OT]
   84930 (MASTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo FTA2 Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 84930
NCBI-ProteinID: NP_001165774
OMIM: 608221
HGNC: 19042
Ensembl: ENSG00000120539
Vega: OTTHUMG00000017855
Pharos: Q96GX5(Tbio)
UniProt: Q96GX5
LinkDB All DBs
Structure
PDB: 

Position
10p12.1
AA seq 879 aa AA seqDB search
MDPTAGSKKEPGGGAATEEGVNRIAVPKPPSIEEFSIVKPISRGAFGKVYLGQKGGKLYA
VKVVKKADMINKNMTHQVQAERDALALSKSPFIVHLYYSLQSANNVYLVMEYLIGGDVKS
LLHIYGYFDEEMAVKYISEVALALDYLHRHGIIHRDLKPDNMLISNEGHIKLTDFGLSKV
TLNRDINMMDILTTPSMAKPRQDYSRTPGQVLSLISSLGFNTPIAEKNQDPANILSACLS
ETSQLSQGLVCPMSVDQKDTTPYSSKLLKSCLETVASNPGMPVKCLTSNLLQSRKRLATS
SASSQSHTFISSVESECHSSPKWEKDCQESDEALGPTMMSWNAVEKLCAKSANAIETKGF
NKKDLELALSPIHNSSALPTTGRSCVNLAKKCFSGEVSWEAVELDVNNINMDTDTSQLGF
HQSNQWAVDSGGISEEHLGKRSLKRNFELVDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQ
NTGLTVEVQDLKLSVHKSQQNDCANKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDC
EKNSKRDYLSSSFLCSDDDRASKNISMNSDSSFPGISIMESPLESQPLDSDRSIKESSFE
ESNIEDPLIVTPDCQEKTSPKGVENPAVQESNQKMLGPPLEVLKTLASKRNAVAFRSFNS
HINASNNSEPSRMNMTSLDAMDISCAYSGSYPMAITPTQKRRSCMPHQQTPNQIKSGTPY
RTPKSVRRGVAPVDDGRILGTPDYLAPELLLGRAHGPAVDWWALGVCLFEFLTGIPPFND
ETPQQVFQNILKRDIPWPEGEEKLSDNAQSAVEILLTIDDTKRAGMKELKRHPLFSDVDW
ENLQHQTMPFIPQPDDETDTSYFEARNTAQHLTVSGFSL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaccgcgggaagcaagaaggagcctggaggaggcgcggcgactgaggagggc
gtgaataggatcgcagtgccaaaaccgccctccattgaggaattcagcatagtgaagccc
attagccggggcgccttcgggaaagtgtatctggggcagaaaggcggcaaattgtatgca
gtaaaggttgttaaaaaagcagacatgatcaacaaaaatatgactcatcaggtccaagct
gagagagatgcactggcactaagcaaaagcccattcattgtccatttgtattattcactg
cagtctgcaaacaatgtctacttggtaatggaatatcttattgggggagatgtcaagtct
ctcctacatatatatggttattttgatgaagagatggctgtgaaatatatttctgaagta
gcactggctctagactaccttcacagacatggaatcatccacagggacttgaaaccggac
aatatgcttatttctaatgagggtcatattaaactgacggattttggcctttcaaaagtt
actttgaatagagatattaatatgatggatatccttacaacaccatcaatggcaaaacct
agacaagattattcaagaaccccaggacaagtgttatcgcttatcagctcgttgggattt
aacacaccaattgcagaaaaaaatcaagaccctgcaaacatcctttcagcctgtctgtct
gaaacatcacagctttctcaaggactcgtatgccctatgtctgtagatcaaaaggacact
acgccttattctagcaaattactaaaatcatgtcttgaaacagttgcctccaacccagga
atgcctgtgaagtgtctaacttctaatttactccagtctaggaaaaggctggccacatcc
agtgccagtagtcaatcccacaccttcatatccagtgtggaatcagaatgccacagcagt
cccaaatgggaaaaagattgccaggaaagtgatgaagcattgggcccaacaatgatgagt
tggaatgcagttgaaaagttatgcgcaaaatctgcaaatgccattgagacgaaaggtttc
aataaaaaggatctggagttagctctttctcccattcataacagcagtgcccttcccacc
actggacgctcttgtgtaaaccttgctaaaaaatgcttctctggggaagtttcttgggaa
gcagtagaactggatgtaaataatataaatatggacactgacacaagtcagttaggtttc
catcagtcaaatcagtgggctgtggattctggtgggatatctgaagagcaccttgggaaa
agaagtttaaaaagaaattttgagttggttgactccagtccttgtaaaaaaattatacag
aataaaaaaacttgtgtagagtataagcataacgaaatgacaaattgttatacaaatcaa
aatacaggcttaacagttgaagtgcaggaccttaagctatcagtgcacaaaagtcaacaa
aatgactgtgctaataaggagaacattgtcaattcttttactgataaacaacaaacacca
gaaaaattacctataccaatgatagcaaaaaaccttatgtgtgaactcgatgaagactgt
gaaaagaatagtaagagggactacttaagttctagttttctatgttctgatgatgataga
gcttctaaaaatatttctatgaactctgattcatcttttcctggaatttctataatggaa
agtccattagaaagtcagcccttagattcagatagaagcatcaaagaatcctcttttgaa
gaatcaaatattgaagatccacttattgtaacaccagattgccaagaaaagacctcacca
aaaggtgtcgagaaccctgctgtacaagagagtaaccaaaaaatgttaggtcctcctttg
gaggtgctgaaaacgttagcctctaaaagaaatgctgttgcttttcgaagttttaacagt
catattaatgcatccaataactcagaaccatccagaatgaacatgacttctttagatgca
atggatatttcgtgtgcctacagtggttcatatcccatggctataacccctactcaaaaa
agaagatcctgtatgccacatcagcagaccccaaatcagatcaagtcgggaactccatac
cgaactccgaagagtgtgagaagaggggtggcccccgttgatgatgggcgaattctagga
accccagactaccttgcacctgagctgttactaggcagggcccatggtcctgcggtagac
tggtgggcacttggagtttgcttgtttgaatttctaacaggaattccccctttcaatgat
gaaacaccacaacaagtattccagaatattctgaaaagagatatcccttggccagaaggt
gaagaaaagttatctgataatgctcaaagtgcagtagaaatacttttaaccattgatgat
acaaagagagctggaatgaaagagctaaaacgtcatcctctcttcagtgatgtggactgg
gaaaatctgcagcatcagactatgcctttcatcccccagccagatgatgaaacagatacc
tcctattttgaagccaggaatactgctcagcacctgactgtatctggatttagtctgtag

DBGET integrated database retrieval system