KEGG   Homo sapiens (human): 84952
Entry
84952             CDS       T01001                                 

Gene name
CGNL1, JACOP, PCING
Definition
(RefSeq) cingulin like 1
  KO
K21110  cingulin-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    84952 (CGNL1)
SSDB
Motif
Pfam: Myosin_tail_1 Crescentin BLOC1_2 Abhydrolase_4
Other DBs
NCBI-GeneID: 84952
NCBI-ProteinID: NP_001239264
OMIM: 607856
HGNC: 25931
Ensembl: ENSG00000128849
Vega: OTTHUMG00000166485
Pharos: Q0VF96(Tbio)
UniProt: Q0VF96
LinkDB
Position
15q21.3
AA seq 1302 aa
MELYFGEYQHVQQEYGVHLRLASDDTQKSRSSQNSKAGSYGVSIRVQGIDGHPYIVLNNT
ERCLAGTSFSENGPPFPPPVINNLPLHSSNGSVPKENSEELQLPENPYAQPSPIRNLKQP
LLHEGKNGVLDRKDGSVKPSHLLNFQRHPELLQPYDPEKNELNLQNHQPSESNWLKTLTE
EGINNKKPWTCFPKPSNSQPTSPSLEDPAKSGVTAIRLCSSVVIEDPKKQTSVCVNVQSC
TKERVGEEALFTSGRPLTAHSPHAHPETKKTRPDVLPFRRQDSAGPVLDGARSRRSSSSS
TTPTSANSLYRFLLDDQECAIHADNVNRHENRRYIPFLPGTGRDIDTGSIPGVDQLIEKF
DQKPGLQRRGRSGKRNRINTDDRKRSRSVDSAFPFGLQGNSEYLIEFSRNLGKSSEHLLR
PSQVCPQRPLSQERRGKQSVGRTFAKLQGAAHGASCAHSRPPQPNIDGKVLETEGSQEST
VIRAPSLGAQSKKEEEVKTATATLMLQNRATATSPDSGAKKISVKTFPSASNTQATPDLL
KGQQELTQQTNEETAKQILYNYLKEGSTDNDDATKRKVNLVFEKIQTLKSRAAGSAQGNN
QACNSTSEVKDLLEQKSKLTIEVAELQRQLQLEVKNQQNIKEERERMRANLEELRSQHNE
KVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRS
EDREKGALIEELLQAKQDLQDLLIAKEEQEDLLRKRERELTALKGALKEEVSSHDQEMDK
LKEQYDAELQALRESVEEATKNVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEE
LERRVAQLQRQIEDLKGDEAKAKETLKKYEGEIRQLEEALVHARKEEKEAVSARRALENE
LEAAQGNLSQTTQEQKQLSEKLKEESEQKEQLRRLKNEMENERWHLGKTIEKLQKEMADI
VEASRTSTLELQNQLDEYKEKNRRELAEMQRQLKEKTLEAEKSRLTAMKMQDEMRLMEEE
LRDYQRAQDEALTKRQLLEQTLKDLEYELEAKSHLKDDRSRLVKQMEDKVSQLEMELEEE
RNNSDLLSERISRSREQMEQLRNELLQERAARQDLECDKISLERQNKDLKSRIIHLEGSY
RSSKEGLVVQMEARIAELEDRLESEERDRANLQLSNRRLERKVKELVMQVDDEHLSLTDQ
KDQLSLRLKAMKRQVEEAEEEIDRLESSKKKLQRELEEQMDMNEHLQGQLNSMKKDLRLK
KLPSKVLDDMDDDDDLSTDGGSLYEAPVSYTFSKDSTVASQI
NT seq 3909 nt   +upstreamnt  +downstreamnt
atggagctgtatttcggtgaatatcaacatgtgcagcaggaatatggggtccatctgaga
ctcgcaagtgatgatacccaaaaatcaaggagttcccagaactccaaggcaggctcctac
ggtgtcagtattcgggtccagggaattgatggtcacccctatattgtcctgaataacaca
gaacggtgcctagcaggcacatcgttttctgaaaatgggccaccctttccacctccagtg
ataaataacctgcctctacattccagcaatggttctgtgccaaaggagaacagtgaagaa
cttcagcttccagaaaacccatacgcccagcctagcccaataagaaacctgaaacagccc
ctgctccatgagggcaagaatggagttctagatcgcaaagacgggtctgtgaagccatct
cacctgctgaactttcagaggcatccagagcttttgcaaccctatgaccctgaaaagaat
gagttgaatttacaaaatcaccagccttctgagagtaattggctaaaaacgttgacagaa
gaaggcatcaacaataagaagccttggacttgctttcccaaacctagcaattcccagcct
accagtccctccttggaagacccggccaaatctggtgtgacagctattcgtttatgcagc
tccgtggtcatagaggaccccaaaaagcagacctcagtgtgtgtaaacgttcagagctgc
accaaggagagggtgggagaggaggcccttttcactagcgggaggcccctgactgcccac
agcccacatgcccaccctgaaaccaagaaaaccaggccagatgttcttcccttccggcga
caggattcagcgggacccgtcctggatggagctcggtcccggaggtcctcctcgtcatcc
acaactcccacgtcagccaactctttgtacaggtttttactggatgatcaggaatgtgcc
atccatgccgacaacgtcaatcgtcatgaaaacagaaggtatattcccttcctgccagga
actggacgggatattgatacaggatcaattcctggtgtggatcagttaattgaaaaattt
gatcaaaaacctgggcttcagagaagaggaaggtctgggaagcgaaacagaattaataca
gatgacaggaaaagatccagaagcgtggatagcgcctttccttttggcctccaagggaac
tcggagtacctgattgaattcagtaggaacttgggcaagtcaagcgaacacctcctccgg
ccttcccaggtgtgcccgcagcggccactgtctcaggagcgccgtgggaaacagagcgtg
ggccgcacctttgcaaagctgcagggagcagcgcacggggcttcatgtgcccactccagg
cctccccagccgaacatagatgggaaagttctggaaaccgaaggtagtcaggaaagtaca
gtgatccgtgcgccctcccttggtgcacagagtaaaaaggaggaggaggtgaaaacagcc
accgctacgctgatgttacagaaccgggcaacagcaacttcgcctgattctggtgccaag
aaaatttccgtgaagacatttccttcggcctcaaatactcaggccacaccggatctctta
aagggccagcaagagctcactcagcaaaccaatgaggagacagctaagcagattctctac
aattacctcaaagaaggaagcactgataatgacgatgctactaaaaggaaagtcaacttg
gtctttgagaaaatccagaccttaaagtctcgagcagctgggagcgcccaaggaaataac
caagcttgtaattccacatctgaagtcaaagatctattggaacagaaaagcaagttgacc
atagaagtggctgaacttcagagacagcttcaactggaagtcaagaatcaacagaacatt
aaagaagagagagagaggatgagagcaaacctagaagagctccgaagccaacacaacgaa
aaggtggaggagaactccacattgcagcaacgactggaagaaagtgaaggggagctccgg
aagaatctggaggagctattccaggtgaagatggaacgggagcagcatcagactgagatc
agggatctccaggaccagctctcagaaatgcacgatgaactggacagtgcaaagcgatcg
gaggacagggagaagggagctctgattgaggagctcttacaggcaaaacaggatcttcaa
gatctgctgattgccaaagaggagcaagaagacctcttgagaaagcgagagcgtgaactc
accgccctgaagggagccctgaaagaagaggtttccagccatgatcaggagatggacaag
ctgaaggagcaatatgatgctgagttgcaggccctgagggagagtgtggaagaagcaacc
aagaatgtcgaggtcttggcgagcaggagcaacacttcagagcaagaccaggcggggact
gaaatgcgcgtgaagcttctgcaggaggagaatgagaagctgcagggaagaagcgaagag
ctggagcggagagttgctcagcttcaaaggcagatcgaggacctgaaaggcgatgaagcc
aaggcgaaggaaacgctgaagaagtacgagggagaaatacgacagttagaggaggccctt
gtgcacgccagaaaggaagaaaaagaagctgtgtcagccagaagggccctggagaatgaa
ctggaggctgctcagggaaatctgagtcagactacccaggagcagaagcagttgtctgag
aagctcaaagaggagagtgagcagaaggagcagctaagaaggttgaagaacgagatggag
aatgagcggtggcacctgggcaaaaccattgagaaactgcagaaggagatggcagacatt
gttgaggcctcccgtacctcaaccctggagctccagaaccagctggatgagtataaggag
aaaaaccgcagggagctcgcagaaatgcaaagacagttgaaggagaaaacgctggaggca
gaaaagtcccgactgacagccatgaaaatgcaggatgagatgcgtctgatggaggaagag
ttacgggactaccagagagctcaggatgaagcactcacaaaaaggcagcttctggagcag
acgctgaaggacctggagtatgagctggaagccaagagtcacctcaaagatgaccgcagc
aggctggtcaagcagatggaggacaaggtgtctcaactggagatggaactggaagaagag
agaaacaactcagatttgctgtctgagaggatcagtaggagcagggaacagatggagcag
ttgaggaatgagctacttcaggagagagctgcgagacaagacttggagtgcgacaagatt
tccctggagaggcagaacaaggacttaaagagccggattatccacctggaaggttcctac
aggtccagcaaagaggggctggttgtgcagatggaggccaggatcgcggagctggaggac
cgcctggagagtgaggagagggatcgggccaatcttcagctcagcaaccggcggctggag
cggaaagtgaaggagctggtgatgcaggtggatgatgagcacctgtcattgactgatcag
aaggaccagctgagcttgcgtttgaaagccatgaagcggcaggtggaggaggctgaggag
gaaatcgacagactggaaagttctaaaaagaagctgcagagggagctggaggagcagatg
gacatgaatgagcatctgcaggggcagctcaactccatgaagaaggacttaagactgaag
aagctgccgagtaaagtgctggatgacatggatgacgacgatgacctcagcacggatggg
ggaagcctctatgaggcgcctgtgagctacacattctccaaggacagcaccgtcgccagc
cagatctga

DBGET integrated database retrieval system