KEGG   Homo sapiens (human): 8504
Entry
8504              CDS       T01001                                 

Gene name
PEX3, PBD10A, PBD10B, TRG18
Definition
(RefSeq) peroxisomal biogenesis factor 3
  KO
K13336  peroxin-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8504 (PEX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8504 (PEX3)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Pexophagy
   Selective cargos
    8504 (PEX3)
SSDB
Motif
Pfam: Peroxin-3
Other DBs
NCBI-GeneID: 8504
NCBI-ProteinID: NP_003621
OMIM: 603164
HGNC: 8858
Ensembl: ENSG00000034693
Vega: OTTHUMG00000015730
Pharos: P56589(Tbio)
UniProt: P56589
LinkDB
Structure
PDB: 
3MK4 3AJB

Position
6q24.2
AA seq 373 aa
MLRSVWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES
NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKNRPSNKLEIWEDLKIISFTRSTVAVY
STCMLVVLLRVQLNIIGGYIYLDNAAVGKNGTTILAPPDVQQQYLSSIQHLLGDGLTELI
TVIKQAVQKVLGSVSLKHSLSLLDLEQKLKEIRNLVEQHKSSSWINKDGSKPLLCHYMMP
DEETPLAVQACGLSPRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFR
PTEQDLQHGNSMNSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLTMEQVKDFAAN
VYEAFSTPQQLEK
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgctgaggtctgtatggaattttctgaaacgccacaaaaagaaatgcatcttcctgggc
acggtccttggaggagtatatattctggggaaatatggacagaagaaaatcagagaaata
caggaaagggaggctgcagaatacattgcccaagcacgacgacaatatcattttgaaagt
aaccagaggacttgcaatatgacagtgctgtccatgcttccaacactgagagaggcctta
atgcagcaactgaattccgagagcctcacagctctgctaaaaaacaggccttcaaacaag
ctagaaatatgggaggatctgaagataataagtttcacaagaagtactgtggctgtatac
agtacctgtatgctggttgttcttttgcgggtccagttaaacataattggtggatatatt
tacctggataatgcagcagttggcaaaaatggcactacaattcttgctcccccagatgtc
caacagcagtatttatcaagtattcagcacctacttggagatggcctgacagaattgatc
actgtcattaaacaagctgtgcagaaggttttaggaagtgtttctcttaaacattctttg
tcccttttggacttggagcaaaaactaaaagaaatcagaaatctcgttgagcagcataag
tcttcttcttggattaataaagatggatccaaacctttattatgccattatatgatgcca
gatgaagaaactccattagcagtgcaggcctgtggactttctcctcgagacattaccact
attaaacttctcaatgaaactagagacatgttggaaagcccagattttagtacagttttg
aatacctgtttaaaccgaggttttagtagacttctagacaatatggctgagttctttcga
cctactgaacaggacctgcaacatggtaactctatgaatagtctttccagtgtcagcctg
cctttagctaagataattccaatagtaaacggacagatccattcagtttgcagtgaaaca
cctagtcattttgttcaggatctgttgacaatggagcaagtgaaagactttgctgctaat
gtgtatgaagcttttagtacccctcagcaactggagaaatga

DBGET integrated database retrieval system