KEGG   Homo sapiens (human): 8517Help
Entry
8517              CDS       T01001                                 

Gene name
IKBKG, AMCBX1, EDAID1, FIP-3, FIP3, Fip3p, IKK-gamma, IKKAP1, IKKG, IMD33, IP, IP1, IP2, IPD2, NEMO, ZC2HC9
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase regulatory subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (virus)
nt06121  TLR signaling (virus)
nt06123  TNF signaling (virus)
nt06124  Chemokine signaling (virus)
nt06133  RIG-I signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06214  PI3K signaling
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00397  HCMV UL26 to NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00467  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00501  HTLV-1 Tax to EGFR-PI3K-NFKB signaling pathway
N00504  HTLV-1 Tax to NFKB signaling pathway
N00506  HTLV-1 Tax to CD40-NFKB signaling pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
N00549  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00561  HSV ICP0 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00564  HSV US3 to TLR3-NFKB signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
H00095  Ectodermal dysplasia associated immunodeficiency
H00540  Osteoporosis, lymphedema, anhydrotic ectodermal dysplasia with immunodeficiency (OLEDAID)
H00645  Incontinentia pigmenti
H01245  Immunodeficiency without anhidrotic ectodermal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8517 (IKBKG)
   04010 MAPK signaling pathway
    8517 (IKBKG)
   04064 NF-kappa B signaling pathway
    8517 (IKBKG)
   04668 TNF signaling pathway
    8517 (IKBKG)
   04151 PI3K-Akt signaling pathway
    8517 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8517 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    8517 (IKBKG)
   04621 NOD-like receptor signaling pathway
    8517 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    8517 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    8517 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    8517 (IKBKG)
   04660 T cell receptor signaling pathway
    8517 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    8517 (IKBKG)
   04659 Th17 cell differentiation
    8517 (IKBKG)
   04657 IL-17 signaling pathway
    8517 (IKBKG)
   04662 B cell receptor signaling pathway
    8517 (IKBKG)
   04062 Chemokine signaling pathway
    8517 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    8517 (IKBKG)
  09158 Development
   04380 Osteoclast differentiation
    8517 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8517 (IKBKG)
   05203 Viral carcinogenesis
    8517 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    8517 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    8517 (IKBKG)
   05221 Acute myeloid leukemia
    8517 (IKBKG)
   05220 Chronic myeloid leukemia
    8517 (IKBKG)
   05215 Prostate cancer
    8517 (IKBKG)
   05222 Small cell lung cancer
    8517 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    8517 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    8517 (IKBKG)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    8517 (IKBKG)
   05131 Shigellosis
    8517 (IKBKG)
   05135 Yersinia infection
    8517 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8517 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    8517 (IKBKG)
   05162 Measles
    8517 (IKBKG)
   05164 Influenza A
    8517 (IKBKG)
   05161 Hepatitis B
    8517 (IKBKG)
   05160 Hepatitis C
    8517 (IKBKG)
   05168 Herpes simplex virus 1 infection
    8517 (IKBKG)
   05163 Human cytomegalovirus infection
    8517 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    8517 (IKBKG)
   05169 Epstein-Barr virus infection
    8517 (IKBKG)
   05165 Human papillomavirus infection
    8517 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    8517 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    8517 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    8517 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8517 (IKBKG)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   8517 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Bacillus_HBL zf_C2H2_ZHX LLC1
Motif
Other DBs
NCBI-GeneID: 8517
NCBI-ProteinID: NP_001093327
OMIM: 300248
HGNC: 5961
Ensembl: ENSG00000269335
Vega: OTTHUMG00000024234
Pharos: Q9Y6K9(Tbio)
UniProt: Q9Y6K9
LinkDB All DBs
Structure
PDB: 

Position
Xq28
AA seq 419 aa AA seqDB search
MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQE
LRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQ
ALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRH
VEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaataggcacctctggaagagccaactgtgtgagatggtgcagcccagtggtggcccg
gcagcagatcaggacgtactgggcgaagagtctcctctggggaagccagccatgctgcac
ctgccttcagaacagggcgctcctgagaccctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagattctgcgggagcgctgcgaggagcttctg
catttccaagccagccagagggaggagaaggagttcctcatgtgcaagttccaggaggcc
aggaaactggtggagagactcggcctggagaagctcgatctgaagaggcagaaggagcag
gctctgcgggaggtggagcacctgaagagatgccagcagcagatggctgaggacaaggcc
tctgtgaaagcccaggtgacgtccttgctcggggagctgcaggagagccagagtcgcttg
gaggctgccactaaggaatgccaggctctggagggtcgggcccgggcggccagcgagcag
gcgcggcagctggagagtgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagggccagagcgtggaggccgcgctccgcatggagcgccaggccgcc
tcggaggagaagaggaagctggcccagttgcaggtggcctatcaccagctcttccaagaa
tacgacaaccacatcaagagcagcgtggtgggcagtgagcggaagcgaggaatgcagctg
gaagatctcaaacagcagctccagcaggccgaggaggccctggtggccaaacaggaggtg
atcgataagctgaaggaggaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcggacttccaggctgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agcaaactgaaggccagctgtcaggagtcggccaggatcgaggacatgaggaagcggcat
gtcgaggtctcccaggcccccttgccccccgcccctgcctacctctcctctcccctggcc
ctgcccagccagaggaggagcccccccgaggagccacctgacttctgctgtcccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system