KEGG   Homo sapiens (human): 8529Help
Entry
8529              CDS       T01001                                 

Gene name
CYP4F2, CPF2
Definition
(RefSeq) cytochrome P450 family 4 subfamily F member 2
  KO
K17726  phylloquinone omega-hydroxylase / docosahexaenoic acid omega-hydroxylase / leukotriene-B4 20-monooxygenase [EC:1.14.14.78 1.14.14.79 1.14.14.94]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    8529 (CYP4F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    8529 (CYP4F2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.78  phylloquinone omega-hydroxylase
     8529 (CYP4F2)
    1.14.14.79  docosahexaenoic acid omega-hydroxylase
     8529 (CYP4F2)
    1.14.14.94  leukotriene-B4 20-monooxygenase
     8529 (CYP4F2)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   8529 (CYP4F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 TetR_C_28
Motif
Other DBs
NCBI-GeneID: 8529
NCBI-ProteinID: NP_001073
OMIM: 604426
HGNC: 2645
Ensembl: ENSG00000186115
Vega: OTTHUMG00000185995
Pharos: P78329(Tbio)
UniProt: P78329
LinkDB All DBs
Position
19p13.12
AA seq 520 aa AA seqDB search
MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF
WGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPK
DKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQL
LASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEIL
LHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFID
VLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQE
LLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIIC
LISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKV
VLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctgagcctgtcctggctgggcctctggccagtggcagcatccccttggctg
ctcctcctgctggtcggggcctcctggctcctggcccatgtcctggcctggacctacgcc
ttctatgacaactgccgccgccttcggtgtttcccacaacccccaagacggaactggttt
tggggacaccagggcatggtcaaccccacagaggagggcatgagagttctgactcagctg
gtggccacctacccccagggctttaaggtctggatgggacccatctcccccctcctcagt
ttgtgccaccccgacatcatccggtctgtcatcaacgcctcagctgccattgcaccaaag
gacaagttcttctacagcttcctggagccctggctgggggatgggctcctgctgagtgct
ggtgacaagtggagccgccaccgtcggatgctgacgcctgccttccatttcaacatcctg
aagccctatatgaagattttcaatgagagtgtgaacatcatgcacgccaagtggcagctc
ctggcctcagagggtagtgcctgtttggatatgtttgagcacatcagcctcatgaccttg
gacagtctacagaaatgtgtcttcagctttgacagccattgtcaggagaaacccagtgaa
tatattgccgccatcttggagctcagtgcccttgtatcaaaaagacaccatgagatcctc
ctgcatattgacttcctgtattatctcacccctgatgggcagcgtttccgcagggcctgc
cgcctggtgcacgacttcacagatgccgtcatccaggagcggcgccgcactctccctagc
cagggtgttgatgacttcctccaagccaaggccaaatccaagactttggacttcattgat
gtactcctgctgagcaaggatgaagacgggaagaagttatctgatgaggacataagagca
gaagctgacacctttatgtttgagggccatgacaccacggccagtggtctctcctgggtc
ctgtaccaccttgcaaagcacccagaataccaggagcgctgccggcaggaggtgcaagaa
cttctgaaggaccgtgagcctaaagagattgaatgggacgacctggcccatttgcccttc
ctgaccatgtgcatgaaggagagcctgcggctgcatcccccagtcccggtcatctcccgc
catgtcacccaggacattgtgctcccagacggccgggtcatccccaaaggcattatctgc
ctcatcagtgttttcggaacccatcacaacccagctgtgtggccggaccctgaggtctac
gacccctttcgctttgacccagagaacatcaaggagaggtcacctctggcttttattccc
ttctcggcagggcccaggaactgcatcgggcagacgttcgcgatggcggagatgaaggtg
gtcctggcgctcacgctgctgcgcttccgcgtcctgcctgaccacaccgagccccgcagg
aagccggagctggtcctgcgcgcagagggcggactttggctgcgggtggagcccctgagc
tga

DBGET integrated database retrieval system