KEGG   Homo sapiens (human): 85363
Entry
85363             CDS       T01001                                 

Gene name
TRIM5, RNF88, TRIM5alpha
Definition
(RefSeq) tripartite motif containing 5
  KO
K10648  tripartite motif-containing protein 5 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    85363 (TRIM5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    85363 (TRIM5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     85363 (TRIM5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    85363 (TRIM5)
SSDB
Motif
Pfam: zf-RING_UBOX zf-C3HC4_4 SPRY zf-C3HC4 zf-C3HC4_2 zf-B_box zf-RING_2 zf-C3HC4_3 zf-RING_5 TMF_TATA_bd U-box FAM76 zf-RING_4 zf-RING_10 zf-Nse Baculo_IE-1
Other DBs
NCBI-GeneID: 85363
NCBI-ProteinID: NP_149023
OMIM: 608487
HGNC: 16276
Ensembl: ENSG00000132256
Vega: OTTHUMG00000066893
Pharos: Q9C035(Tbio)
UniProt: Q9C035
LinkDB
Structure
PDB: 
2YRG 2ECV

Position
11p15.4
AA seq 493 aa
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQ
GSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHY
WEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
KCGVPMTLCSPSS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcttctggaatcctggttaatgtaaaggaggaggtgacctgccccatctgcctggaa
ctcctgacacaacccctgagcctggactgcggccacagcttctgccaagcatgcctcact
gcaaaccacaagaagtccatgctagacaaaggagagagtagctgccctgtgtgccggatc
agttaccagcctgagaacatacggcctaatcggcatgtagccaacatagtggagaagctc
agggaggtcaagttgagcccagaggggcagaaagttgatcattgtgcacgccatggagag
aaacttctactcttctgtcaggaggacgggaaggtcatttgctggctttgtgagcggtct
caggagcaccgtggtcaccacacgttcctcacagaggaggttgcccgggagtaccaagtg
aagctccaggcagctctggagatgctgaggcagaagcagcaggaagctgaagagttagaa
gctgacatcagagaagagaaagcttcctggaagactcaaatacagtatgacaaaaccaac
gtcttggcagattttgagcaactgagagacatcctggactgggaggagagcaatgagctg
caaaacctggagaaggaggaggaagacattctgaaaagccttacgaactctgaaactgag
atggtgcagcagacccagtccctgagagagctcatctcagatctggagcatcggctgcag
gggtcagtgatggagctgcttcagggtgtggatggcgtcataaaaaggacggagaacgtg
accttgaagaagccagaaacttttccaaaaaatcaaaggagagtgtttcgagctcctgat
ctgaaaggaatgctagaagtgtttagagagctgacagatgtccgacgctactgggttgat
gtgacagtggctccaaacaacatttcatgtgctgtcatttctgaagataagagacaagtg
agctctccgaaaccacagataatatatggggcacgagggacaagataccagacatttgtg
aatttcaattattgtactggcatcctgggctctcaaagtatcacatcagggaaacattac
tgggaggtagacgtgtccaagaaaactgcttggatcctgggggtatgtgctggcttccaa
cctgatgcaatgtgtaatattgaaaaaaatgaaaattatcaacctaaatacggctactgg
gttatagggttagaggaaggagttaaatgtagtgctttccaggatagttccttccatact
ccttctgttcctttcattgtgcccctctctgtgattatttgtcctgatcgtgttggagtt
ttcctagactatgaggcttgcactgtctcattcttcaatatcacaaaccatggatttctc
atctataagttttctcactgttctttttctcagcctgtatttccatatttaaatcctaga
aaatgtggagtccccatgactctgtgctcaccaagctcttga

DBGET integrated database retrieval system