KEGG   Homo sapiens (human): 85445
Entry
85445             CDS       T01001                                 

Gene name
CNTNAP4, CASPR4
Definition
(RefSeq) contactin associated protein family member 4
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C Laminin_G_3 EGF COLFI EGF_2
Other DBs
NCBI-GeneID: 85445
NCBI-ProteinID: NP_207837
OMIM: 610518
HGNC: 18747
Ensembl: ENSG00000152910
Vega: OTTHUMG00000137617
Pharos: Q9C0A0(Tbio)
UniProt: Q9C0A0
LinkDB
Position
16q23.1
AA seq 1308 aa
MGSVTGAVLKTLLLLSTQNWNRVEAGNSYDCDDPLVSALPQASFSSSSELSSSHGPGFAR
LNRRDGAGGWSPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNW
KQYRQEDSIWGFSGNANADSVVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYR
SEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTMQSDGILLHREGPNGDHITLQLRRAR
LFLLINSGEAKLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE
FNLMNLDYEISFGGIPAPGKSVSFPHRNFHGCLENLYYNGVDIIDLAKQQKPQIIAMGNV
SFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISGGIL
LFLSDGKLKSNLYQPGKLPSDITAGVELNDGQWHSVSLSAKKNHLSVAVDGQMASAAPLL
GPEQIYSGGTYYFGGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLGNFS
DLQIDSCGISDRCLPNYCEHGGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAYKHR
GNTSGFYYIDSDGSGPLEPFLLYCNMTETAWTIIQHNGSDLTRVRNTNPENPYAGFFEYV
ASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSWWVGRTNETQTYWGGSSPDLQ
KCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTGRLHSEAAYKL
GPLLCQGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIADFI
RIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRVERNMKEASLQVDQLTPKTQ
PAPADGHVLLQLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPGCRG
HCSSYGKLCRNGGKCRERPIGFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQENYLL
SKNSSSHAASFHGDMKLSREMIKFSFRTTRTPSLLLFVSSFYKEYLSVIIAKNGSLQIRY
KLNKYQEPDVVNFDFKNMADGQLHHIMINREEGVVFIEIDDNRRRQVHLSSGTEFSAVKS
LVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTES
SCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCITAI
AVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgggatctgtcacgggagctgtcctcaagacgctacttctgttatctactcaaaattgg
aacagagtcgaagctgggaattcctatgactgtgatgatcctcttgtgtctgccttgcct
caggcatccttcagcagttcttccgagctctccagcagtcatggtcctggatttgcaagg
ctgaatagaagagatggagctggtggctggtctccacttgtgtctaacaaataccagtgg
ttgcagattgaccttggagagagaatggaggtcaccgctgtggccactcaagggggatat
ggtagctccaactgggtgaccagctacctcctgatgttcagtgatagtggctggaactgg
aaacaatatcgccaagaggacagcatctggggtttttcaggaaatgcaaatgcagacagt
gttgtgtactatagactccagccttctatcaaagccagatttctgcgcttcatccctttg
gaatggaaccccaagggcagaattggaatgcgaatcgaagtgttcggatgtgcatacaga
tcagaagtggttgatcttgatggaaaaagttcccttctctacagatttgatcaaaaatcc
ctgagcccaataaaagacattatttctttgaaattcaaaaccatgcagagtgatgggatt
ctactccacagggaagggccaaatggagatcacatcacactgcaattaagaagagcaaga
ctctttttacttattaattcaggtgaagctaaactgccttccacttccaccctggtcaat
ctcaccctgggcagcctgctagatgatcagcattggcattcagtgctcatccagcgtttg
ggcaaacaagtcaacttcacagtggacgaacacaggcatcatttccatgcacggggagaa
ttcaatctcatgaatcttgattatgagatcagctttggagggattccagcacctggaaaa
tcagtgtcattcccacatagaaattttcatggatgtttagaaaatctctattataatgga
gtggatatcattgatttggccaagcagcaaaaaccacagatcattgctatgggaaatgtg
tcattttcttgttcacaaccacaatctatgcccgtgacttttctgagctccaggagttat
ttagcactgccagacttctctggagaggaggaggtttctgccacttttcaatttcgaact
tggaataaggcagggcttctgctgttcagtgaacttcagctgatttcagggggtatcctc
ctctttctgagtgatggaaaacttaagtcgaatctctaccagccaggaaaattacccagt
gacatcacagcaggtgtcgaattaaatgatgggcagtggcattctgtctctttatctgct
aaaaagaatcacttgagtgtggcggtggacggccagatggcttctgctgctcctctgctg
gggcctgagcagatttattcgggtggcacctattattttggaggttgtcctgacaaaagc
tttggatccaaatgtaaaagtccacttggtggatttcagggatgtatgaggctcatttct
atcagcggcaaagtggtagatctgatttcagttcagcaggggtcccttgggaacttcagt
gaccttcagatagactcatgtggcatctcagacaggtgtttgcccaactattgtgaacac
ggtggggagtgttcccagtcctggagcacctttcattgtaactgtaccaacactggttac
agaggagctacttgccataactctatctatgagcagtcatgtgaagcctataagcacaga
ggaaatacttcagggttttactatatagattcagatggaagtggtcccctggaaccattt
cttctatattgcaatatgaccgaaactgcatggaccatcatacagcacaacggctctgac
ttaacaagagtcagaaatactaatccagagaacccatatgctgggtttttcgagtatgtg
gccagcatggagcaacttcaggccactattaaccgtgcagagcactgtgaacaggagttt
acttattactgcaagaagtcacggctggtcaataagcaagatggaacccctctgagttgg
tgggtaggaagaaccaatgaaacgcaaacctactggggaggttcttcgcctgatcttcaa
aaatgtacttgtggattagagggaaactgcattgattctcagtattactgcaattgtgat
gctgaccggaatgaatggaccaatgacactggattgcttgcttataaagaacatcttcca
gtaactaagatcgtgattacagacacaggccgactgcattcagaagcagcttataaactg
gggcctctgctctgccagggagacagatcattttggaattcagcttcctttgataccgag
gcttcatatcttcattttcctaccttccacggagaacttagcgcggatgtatctttcttt
tttaagacaacagcttcatctggggtatttttagagaacttggggattgctgattttata
cggatagagcttcgctctccgacagtagtgactttttcatttgatgtggggaatgggcct
tttgaaatctcagtgcagtcacccacccacttcaacgacaaccagtggcaccatgtgagg
gttgaaaggaacatgaaggaggcctcccttcaagtggatcagctgacaccaaagacacag
cccgcccccgctgatgggcatgtcctgttacagctcaacagtcagctcttcgtgggtgga
acggccaccagacagagaggctttctgggctgcattcggtctctgcagttgaatgggatg
accctggatttggaagaaagagcccaggtgactccagaagtgcagccaggttgtagggga
cattgcagcagctatgggaagttatgccgcaatggagggaaatgcagagaaagacccatt
gggttcttttgtgactgcactttctctgcatacacagggccattctgctcaaatgagatt
tctgcatattttggatctggctcatccgtgatatacaattttcaagaaaattatctttta
agtaaaaactccagctcccacgctgcttcatttcatggtgatatgaagctgagcagagaa
atgatcaaatttagtttccgaacaacacgaacaccaagcttgctgctttttgtgagctcc
ttttacaaagaatacctttctgtgatcattgccaaaaatggaagtttgcagatcaggtac
aagttaaataaatatcaagagcctgatgttgttaactttgattttaaaaacatggctgat
ggacaacttcaccacataatgattaacagagaagaaggagtggtctttatagagattgac
gataatagaaggagacaagttcacctgtcatcaggcacagaattcagtgcagtcaaatct
ctggtattgggcaggattttagaacacagtgatgtggaccaggatactgcactggcaggt
gcgcagggcttcacaggctgcctctctgcagtgcagctcagccacgtggcccctctgaag
gcagctctgcaccccagccacccagaccctgtcactgttacaggacacgtgactgagtcc
agctgtatggcccagcctggcactgatgccacatcaagggaaaggacacactcgtttgca
gatcattctggaacaatagatgacagagagccccttgctaatgcaatcaaaagtgactct
gcagtaattggaggtctgatagctgttgtgatttttatcttgctttgcatcactgccata
gctgttcgcatttatcagcagaaaaggttatataaaagaagtgaggcaaaaaggtcagag
aatgtagacagtgctgaggctgttctgaaaagtgagcttaatatacaaaatgcagtcaat
gaaaatcagaaagagtacttcttctga

DBGET integrated database retrieval system