KEGG   Homo sapiens (human): 85451
Entry
85451             CDS       T01001                                 

Gene name
UNK, UNKEMPT, ZC3H5, ZC3HDC5
Definition
(RefSeq) unk zinc finger
  KO
K23048  RING finger protein unkempt
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    85451 (UNK)
SSDB
Motif
Pfam: zf_CCCH_5 zf-CCCH DUF3450 zf-C3HC4_3 zf_CCCH_4 THOC7 DUF4407 Fez1 DUF3560 Filament Spc7 DUF4201 Crescentin CENP-Q MscS_porin
Other DBs
NCBI-GeneID: 85451
NCBI-ProteinID: NP_001073888
OMIM: 616375
HGNC: 29369
Ensembl: ENSG00000132478
Vega: OTTHUMG00000179892
Pharos: Q9C0B0(Tbio)
UniProt: Q9C0B0 A0A024R8N4
LinkDB
Position
17q25.1
AA seq 810 aa
MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYT
CFHWHFVNQRRRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRY
HLRYYKTGICIHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVE
GSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNS
KDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
DMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSS
PHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER
EDQVGAEYLKNFKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSS
LAATPPSPVGTSSVPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNST
VPHPGSITIGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
TFLGTSASHGSLGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANST
IKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERL
HAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL
PCQHAALCELCAEGSECPICQPGRAHTLQS
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgtcgaagggccccgggcccggcggctccgcagcttcctcggcgcccccggccgctacc
gctcaggtgctgcaggcacagcccgagaaaccgcagcactacacgtacctgaaagaattc
cgcacagagcagtgcccactctttgtgcaacacaaatgcacgcagcatcggccctacacc
tgcttccactggcacttcgtgaaccagcggcgccgccggtccatccgccgtcgggacggc
accttcaattacagccctgacgtctactgcaccaagtacgacgaggctacaggcctctgc
ccggagggcgacgagtgcccattcctgcacagaaccacaggggacactgagcgcaggtac
caccttcgttactacaaaactggaatctgcatccacgagacagactcgaaaggcaactgc
accaaaaacggcctgcactgcgcttttgcccacgggccccatgacctccgctcccctgtc
tacgacatcagggagcttcaggccatggaggccttgcagaatggccagaccacggtagag
gggagcatagagggccagtcggctggggctgcgagccatgccatgatagaaaagatcctc
agcgaggagcctcggtggcaagagactgcttatgtgctggggaactataagacggagcct
tgcaagaagcccccgcggctgtgccgccaaggctatgcctgtccctactaccacaacagc
aaggaccggcggcggagcccccggaagcacaaatacaggtcgtctccatgtccaaacgtc
aagcacggggatgagtggggagaccctggcaagtgtgagaacggagacgcctgccagtac
tgccacacccgcaccgagcagcagttccaccccgagatctacaagtccaccaagtgcaac
gacatgcagcagtcgggcagctgtccccgaggacccttctgcgcctttgcccacgtagaa
cagccacccctgagtgacgacctgcagccttcctcagctgtgtccagccccacccagcca
ggtcctgtcctgtacatgccatctgccgccggagactcggtgcctgtgagcccctccagc
ccgcatgcccctgacctcagtgccctcctctgtagaaacagcagcctaggcagcccgtct
aacctctgcggctccccaccgggctccatcaggaagcccccaaacctggagggcatcgtc
ttccctggggagtctggcctggcccctggcagctataagaaggctcccggcttcgagagg
gaagaccaggtgggagccgagtacctgaaaaatttcaaatgccaggccaaattaaaaccc
cactcattagagcccaggagtcaagagcagcctctgcttcagcccaaacaggacatgctg
ggcatcctccccgcaggcagccccctgacctcaagcatctcttctagtatcacctccagc
ctggcagctaccccccctagcccagtgggcaccagcagcgtccccggcatgaatgcaaac
gctctgcccttctaccccaccagcgacacggtagagtcagtcatagagtctgctttggat
gacctggacctgaatgagtttggcgtggccgccctggagaagactttcgataacagcaca
gtgccccacccaggaagcatcaccatcggcggcagcttgctgcagagctctgcacccgtg
aacatccccggctccttgggcagctctgcctccttccactcagcatccccgtcccctccc
gtcagcctctcctcgcatttcctgcagcagccccagggccacctgagtcagtcggaaaac
acatttttgggaacctcagcatcacatggatctttgggtctgaacgggatgaacagcagc
atctgggagcattttgcctctggaagcttctccccgggcacttcccccgctttcctatca
gggccaggggctgccgagctggcccgacttcggcaagagctggatgaagccaacagcacc
atcaagcagtgggaggagtcctggaagcaggccaagcaggcttgtgatgcctggaagaaa
gaggcggaggaggctggtgagcgggccagtgcggcgggcgccgagtgcgagctggcccgg
gagcagcgggatgcactggaggtgcaggtgaagaagctccaggaggagctggagcggcta
cacgcggggcctgagccccaggccctgcccgccttctccgacctggaggcgctctcactc
tccaccctctactccctccagaaacaactgcgggcccacctggaacaagtggacaaggcc
gtgttccacatgcagtcggtgaaatgccttaagtgtcaggaacagaagcgggcagtgctg
ccgtgccaacacgctgcgctgtgtgagctctgcgctgagggcagcgagtgccccatctgc
cagcctggccgggcccacaccctccagtcgtga

DBGET integrated database retrieval system