KEGG   Homo sapiens (human): 857Help
Entry
857               CDS       T01001                                 

Gene name
CAV1, BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21, CAV
Definition
(RefSeq) caveolin 1
  KO
K06278  caveolin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00419  Congenital generalized lipodystrophy
H01621  Pulmonary arterial hypertension
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    857 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    857 (CAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    857 (CAV1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    857 (CAV1)
   05416 Viral myocarditis
    857 (CAV1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    857 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    857 (CAV1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    857 (CAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 857
NCBI-ProteinID: NP_001744
OMIM: 601047
HGNC: 1527
Ensembl: ENSG00000105974
Vega: OTTHUMG00000023413
Pharos: Q03135(Tbio)
UniProt: Q03135 Q2TNI1 Q59E85
LinkDB All DBs
Position
7q31.2
AA seq 178 aa AA seqDB search
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgagctgagcgagaagcaa
gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac
gatgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
tttgacggcatttggaaggccagcttcaccaccttcactgtgacgaaatactggttttac
cgcttgctgtctgccctctttggcatcccgatggcactcatctggggcatttacttcgcc
attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt
gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatataa

KEGG   Homo sapiens (human): 858Help
Entry
858               CDS       T01001                                 

Gene name
CAV2, CAV
Definition
(RefSeq) caveolin 2
  KO
K12958  caveolin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    858 (CAV2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    858 (CAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    858 (CAV2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    858 (CAV2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    858 (CAV2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    858 (CAV2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    858 (CAV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin SPC12
Motif
Other DBs
NCBI-GeneID: 858
NCBI-ProteinID: NP_001224
OMIM: 601048
HGNC: 1528
Ensembl: ENSG00000105971
Vega: OTTHUMG00000023414
Pharos: P51636(Tbio)
UniProt: P51636 Q53X57
LinkDB All DBs
Position
7q31.2
AA seq 162 aa AA seqDB search
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagacggagaaggcggacgtacagctcttcatggacgacgactcctacagc
caccacagcggcctcgagtacgccgaccccgagaagttcgcggactcggaccaggaccgg
gatccccaccggctcaactcgcatctcaagctgggcttcgaggatgtgatcgcagagccg
gtgactacgcactcctttgacaaagtgtggatctgcagccatgccctctttgaaatcagc
aaatacgtaatgtacaagttcctgacggtgttcctggccattcccctggccttcattgcg
ggaattctctttgccaccctcagctgtctgcacatctggattttaatgccttttgtaaag
acctgcctaatggttctgccttcagtgcagacaatatggaagagtgtgacagatgttatc
attgctccattgtgtacgagcgtaggacgatgcttctcttctgtcagcctgcaactgagc
caggattga

KEGG   Homo sapiens (human): 859Help
Entry
859               CDS       T01001                                 

Gene name
CAV3, LGMD1C, LQT9, MPDT, RMD2, VIP-21, VIP21
Definition
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00567  Limb-girdle muscular dystrophy 1C
H00593  Limb-girdle muscular dystrophy
H00594  Distal myopathy
H00720  Long QT syndrome
H02179  Rippling muscle disease
H02181  Idiopathic hyperCKemia
H02182  Distal myopathy, Tateyama type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    859 (CAV3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    859 (CAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    859 (CAV3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    859 (CAV3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    859 (CAV3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    859 (CAV3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    859 (CAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 859
NCBI-ProteinID: NP_001225
OMIM: 601253
HGNC: 1529
Ensembl: ENSG00000182533
Vega: OTTHUMG00000090519
Pharos: P56539(Tbio)
UniProt: P56539 A0A024R2D8
LinkDB All DBs
Position
3p25.3
AA seq 151 aa AA seqDB search
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatggcagaagagcacacagatctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaagaacattaacgaggacatagtcaaggtggat
tttgaagacgtgatcgcagagcctgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcactgtctccaagtactggtgctaccgtctgttgtccacgctgctg
ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccatgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system