KEGG   Homo sapiens (human): 8572
Entry
8572              CDS       T01001                                 

Gene name
PDLIM4, RIL
Definition
(RefSeq) PDZ and LIM domain 4
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
hsa  Homo sapiens (human)
Disease
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    8572 (PDLIM4)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  PDZ-LIM family proteins
   8572 (PDLIM4)
SSDB
Motif
Pfam: PDZ LIM DUF4749 PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 8572
NCBI-ProteinID: NP_003678
OMIM: 603422
HGNC: 16501
Ensembl: ENSG00000131435
Vega: OTTHUMG00000059645
Pharos: P50479(Tbio)
UniProt: P50479
LinkDB
Structure
PDB: 
2V1W 4Q2O 2EEG

Position
5q31.1
AA seq 330 aa
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPS
GTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSR
DCRVDLGSEVYRMLREPAEPVAAEPKQSGSFRYLQGMLEAGEGGDWPGPGGPRNLKPTAS
KLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCESHAKARVKPPEGYDVVAVYPNAKVELV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgccccattccgtgaccctgcgcgggccttcgccctggggcttccgcctggtgggcggc
cgggacttcagcgcgcccctcaccatctcacgggtccatgctggcagcaaggctgcattg
gctgccctgtgcccaggagacctgatccaggccatcaatggtgagagcacagagctcatg
acacacctggaggcacagaaccgcatcaagggctgccacgatcacctcacactgtctgtg
agcaggcctgagggtaggagctggcccagtgcccctgatgacagcaaggctcaggcacac
aggatccacatcgatcctgagatccaggacggcagcccaacaaccagcaggcggccctca
ggcaccgggactgggccagaagatggcagaccaagcctgggatctccatatggacaaccc
cctcgctttccagtccctcacaatggcagcagcgaggccaccctgccagcccagatgagc
accctgcatgtgtctccaccccccagcgctgacccagccagaggcctcccgcggagccgg
gactgcagagtcgacctgggctccgaggtgtacaggatgctgcgggagccagccgagccc
gtggccgcggagcccaagcagtcaggctccttccgctacttgcagggcatgctagaggcc
ggcgagggcggggattggcccgggcctggcggcccccggaacctcaagcccacggccagc
aagctgggcgctccgctgagcggcctgcaggggctgcccgagtgcacgcgctgcggccac
ggcatcgtgggcaccatcgtcaaggcacgggacaagctctaccatcccgagtgcttcatg
tgcagtgactgcggcctgaacctcaagcagcgtggttacttctttctggacgagcggctc
tactgtgagagccacgccaaggcgcgcgtgaagccgcccgagggctacgacgtggtggcg
gtgtaccccaatgccaaggtggaactcgtctga

DBGET integrated database retrieval system