KEGG   Homo sapiens (human): 8572Help
Entry
8572              CDS       T01001                                 

Gene name
PDLIM4, RIL
Definition
(RefSeq) PDZ and LIM domain 4
  KO
K23353  PDZ and LIM domain protein 1/2/3/4
Organism
hsa  Homo sapiens (human)
Disease
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    8572 (PDLIM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ LIM DUF4749 PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 8572
NCBI-ProteinID: NP_003678
OMIM: 603422
HGNC: 16501
Ensembl: ENSG00000131435
Vega: OTTHUMG00000059645
Pharos: P50479(Tbio)
UniProt: P50479
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 330 aa AA seqDB search
MPHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELM
THLEAQNRIKGCHDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPEIQDGSPTTSRRPS
GTGTGPEDGRPSLGSPYGQPPRFPVPHNGSSEATLPAQMSTLHVSPPPSADPARGLPRSR
DCRVDLGSEVYRMLREPAEPVAAEPKQSGSFRYLQGMLEAGEGGDWPGPGGPRNLKPTAS
KLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL
YCESHAKARVKPPEGYDVVAVYPNAKVELV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccccattccgtgaccctgcgcgggccttcgccctggggcttccgcctggtgggcggc
cgggacttcagcgcgcccctcaccatctcacgggtccatgctggcagcaaggctgcattg
gctgccctgtgcccaggagacctgatccaggccatcaatggtgagagcacagagctcatg
acacacctggaggcacagaaccgcatcaagggctgccacgatcacctcacactgtctgtg
agcaggcctgagggtaggagctggcccagtgcccctgatgacagcaaggctcaggcacac
aggatccacatcgatcctgagatccaggacggcagcccaacaaccagcaggcggccctca
ggcaccgggactgggccagaagatggcagaccaagcctgggatctccatatggacaaccc
cctcgctttccagtccctcacaatggcagcagcgaggccaccctgccagcccagatgagc
accctgcatgtgtctccaccccccagcgctgacccagccagaggcctcccgcggagccgg
gactgcagagtcgacctgggctccgaggtgtacaggatgctgcgggagccagccgagccc
gtggccgcggagcccaagcagtcaggctccttccgctacttgcagggcatgctagaggcc
ggcgagggcggggattggcccgggcctggcggcccccggaacctcaagcccacggccagc
aagctgggcgctccgctgagcggcctgcaggggctgcccgagtgcacgcgctgcggccac
ggcatcgtgggcaccatcgtcaaggcacgggacaagctctaccatcccgagtgcttcatg
tgcagtgactgcggcctgaacctcaagcagcgtggttacttctttctggacgagcggctc
tactgtgagagccacgccaaggcgcgcgtgaagccgcccgagggctacgacgtggtggcg
gtgtaccccaatgccaaggtggaactcgtctga

DBGET integrated database retrieval system