KEGG   Homo sapiens (human): 859Help
Entry
859               CDS       T01001                                 

Gene name
CAV3, LGMD1C, LQT9, VIP-21, VIP21
Definition
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00567  Caveolinopathies
H00593  Limb-girdle muscular dystrophy (LGMD)
H00720  Long QT syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    859 (CAV3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    859 (CAV3)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    859 (CAV3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    859 (CAV3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    859 (CAV3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    859 (CAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 859
NCBI-ProteinID: NP_001225
OMIM: 601253
HGNC: 1529
Ensembl: ENSG00000182533
Vega: OTTHUMG00000090519
Pharos: P56539(Tbio)
UniProt: P56539 A0A024R2D8
LinkDB All DBs
Position
3p25.3
AA seq 151 aa AA seqDB search
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatggcagaagagcacacagatctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaagaacattaacgaggacatagtcaaggtggat
tttgaagacgtgatcgcagagcctgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcactgtctccaagtactggtgctaccgtctgttgtccacgctgctg
ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccatgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system