KEGG   Homo sapiens (human): 859Help
Entry
859               CDS       T01001                                 

Gene name
CAV3, LGMD1C, LQT9, MPDT, RMD2, VIP-21, VIP21
Definition
(RefSeq) caveolin 3
  KO
K12959  caveolin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00567  Limb-girdle muscular dystrophy 1C
H00593  Limb-girdle muscular dystrophy
H00594  Distal myopathy
H00720  Long QT syndrome
H02179  Rippling muscle disease
H02181  Idiopathic hyperCKemia
H02182  Distal myopathy, Tateyama type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    859 (CAV3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    859 (CAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    859 (CAV3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    859 (CAV3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    859 (CAV3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    859 (CAV3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    859 (CAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 859
NCBI-ProteinID: NP_001225
OMIM: 601253
HGNC: 1529
Ensembl: ENSG00000182533
Vega: OTTHUMG00000090519
Pharos: P56539(Tbio)
UniProt: P56539 A0A024R2D8
LinkDB All DBs
Position
3p25.3
AA seq 151 aa AA seqDB search
MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV
SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSSIKVVLRKEV
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatggcagaagagcacacagatctcgaggcccagatcgtcaaggatatccactgcaag
gagattgacctggtgaaccgagaccccaagaacattaacgaggacatagtcaaggtggat
tttgaagacgtgatcgcagagcctgtgggcacctacagctttgacggcgtgtggaaggtg
agctacaccaccttcactgtctccaagtactggtgctaccgtctgttgtccacgctgctg
ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc
tgggcggtggtgccatgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactctgcatccgcaccttctgcaacccactcttcgcggccctgggccaggtctgc
agcagcatcaaggtggtgctgcggaaggaggtctaa

DBGET integrated database retrieval system