KEGG   Homo sapiens (human): 8600Help
Entry
8600              CDS       T01001                                 

Gene name
TNFSF11, CD254, ODF, OPGL, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2, sOdf
Definition
(RefSeq) TNF superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04917  Prolactin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05224  Breast cancer
hsa05323  Rheumatoid arthritis
Disease
H00436  Osteopetrosis
H01470  Giant cell tumor of bone
Drug target
Denosumab: D03684
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    8600 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8600 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    8600 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    8600 (TNFSF11)
  09158 Development
   04380 Osteoclast differentiation
    8600 (TNFSF11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    8600 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    8600 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8600 (TNFSF11)
   04090 CD molecules [BR:hsa04090]
    8600 (TNFSF11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8600 (TNFSF11)
CD molecules [BR:hsa04090]
 Proteins
  8600 (TNFSF11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 8600
NCBI-ProteinID: NP_003692
OMIM: 602642
HGNC: 11926
Ensembl: ENSG00000120659
Vega: OTTHUMG00000016807
Pharos: O14788(Tclin)
UniProt: O14788 Q5T9Y4
LinkDB All DBs
Structure
PDB: 

Position
13q14.11
AA seq 317 aa AA seqDB search
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgccagcagagactacaccaagtacctgcgtggctcggaggagatgggcggc
ggccccggagccccgcacgagggccccctgcacgccccgccgccgcctgcgccgcaccag
ccccctgccgcctcccgctccatgttcgtggccctcctggggctggggctgggccaggtt
gtctgcagcgtcgccctgttcttctatttcagagcgcagatggatcctaatagaatatca
gaagatggcactcactgcatttatagaattttgagactccatgaaaatgcagattttcaa
gacacaactctggagagtcaagatacaaaattaatacctgattcatgtaggagaattaaa
caggcctttcaaggagctgtgcaaaaggaattacaacatatcgttggatcacagcacatc
agagcagagaaagcgatggtggatggctcatggttagatctggccaagaggagcaagctt
gaagctcagccttttgctcatctcactattaatgccaccgacatcccatctggttcccat
aaagtgagtctgtcctcttggtaccatgatcggggttgggccaagatctccaacatgact
tttagcaatggaaaactaatagttaatcaggatggcttttattacctgtatgccaacatt
tgctttcgacatcatgaaacttcaggagacctagctacagagtatcttcaactaatggtg
tacgtcactaaaaccagcatcaaaatcccaagttctcataccctgatgaaaggaggaagc
accaagtattggtcagggaattctgaattccatttttattccataaacgttggtggattt
tttaagttacggtctggagaggaaatcagcatcgaggtctccaacccctccttactggat
ccggatcaggatgcaacatactttggggcttttaaagttcgagatatagattga

DBGET integrated database retrieval system