KEGG   Homo sapiens (human): 8611Help
Entry
8611              CDS       T01001                                 

Gene name
PLPP1, LLP1a, LPP1, PAP-2a, PAP2, PPAP2A
Definition
(RefSeq) phospholipid phosphatase 1
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04975  Fat digestion and absorption
hsa05231  Choline metabolism in cancer
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8611 (PLPP1)
   00564 Glycerophospholipid metabolism
    8611 (PLPP1)
   00565 Ether lipid metabolism
    8611 (PLPP1)
   00600 Sphingolipid metabolism
    8611 (PLPP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    8611 (PLPP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8611 (PLPP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    8611 (PLPP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8611 (PLPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8611 (PLPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 PAP2_C COX4 PAP2_3 TPPK_C
Motif
Other DBs
NCBI-GeneID: 8611
NCBI-ProteinID: NP_003702
OMIM: 607124
HGNC: 9228
Ensembl: ENSG00000067113
Vega: OTTHUMG00000162240
Pharos: O14494(Tbio)
UniProt: O14494 A0A024QZS3
LinkDB All DBs
Position
5q11.2
AA seq 284 aa AA seqDB search
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLG
GIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAK
YSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCML
FVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI
LVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaagacgcggctgccgtacgtggccctcgatgtgctctgcgtgttgctggct
ggattgccttttgcaattcttacttcaaggcatacccccttccaacgaggagtattctgt
aatgatgagtccatcaagtacccttacaaagaagacaccataccttatgcgttattaggt
ggaataatcattccattcagtattatcgttattattcttggagaaaccctgtctgtttac
tgtaaccttttgcactcaaattcctttatcaggaataactacatagccactatttacaaa
gccattggaacctttttatttggtgcagctgctagtcagtccctgactgacattgccaag
tattcaataggcagactgcggcctcacttcttggatgtttgtgatccagattggtcaaaa
atcaactgcagcgatggttacattgaatactacatatgtcgagggaatgcagaaagagtt
aaggaaggcaggttgtccttctattcaggccactcttcgttttccatgtactgcatgctg
tttgtggcactttatcttcaagccaggatgaagggagactgggcaagactcttacgcccc
acactgcaatttggtcttgttgccgtatccatttatgtgggcctttctcgagtttctgat
tataaacaccactggagcgatgtgttgactggactcattcagggagctctggttgcaata
ttagttgctgtatatgtatcggatttcttcaaagaaagaacttcttttaaagaaagaaaa
gaggaggactctcatacaactctgcatgaaacaccaacaactgggaatcactatccgagc
aatcaccagccttga

KEGG   Homo sapiens (human): 8612Help
Entry
8612              CDS       T01001                                 

Gene name
PLPP2, LPP2, PAP-2c, PAP2-g, PPAP2C
Definition
(RefSeq) phospholipid phosphatase 2
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04975  Fat digestion and absorption
hsa05231  Choline metabolism in cancer
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8612 (PLPP2)
   00564 Glycerophospholipid metabolism
    8612 (PLPP2)
   00565 Ether lipid metabolism
    8612 (PLPP2)
   00600 Sphingolipid metabolism
    8612 (PLPP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    8612 (PLPP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8612 (PLPP2)
  09154 Digestive system
   04975 Fat digestion and absorption
    8612 (PLPP2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8612 (PLPP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8612 (PLPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 LrgB Form_Nir_trans PAP2_C DUF2976
Motif
Other DBs
NCBI-GeneID: 8612
NCBI-ProteinID: NP_003703
OMIM: 607126
HGNC: 9230
Ensembl: ENSG00000141934
Vega: OTTHUMG00000180530
Pharos: O43688(Tbio)
UniProt: O43688
LinkDB All DBs
Position
19p13.3
AA seq 288 aa AA seqDB search
MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV
TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI
GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA
LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV
CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggaggtgggtcttcgtgctgctcgacgtgctgtgcttactggtcgcctccctg
cccttcgctatcctgacgctggtgaacgccccgtacaagcgaggattttactgcggggat
gactccatccggtacccctaccgtccagataccatcacccacgggctcatggctggggtc
accatcacggccaccgtcatccttgtctcggccggggaagcctacctggtgtacacagac
cggctctattctcgctcggacttcaacaactacgtggctgctgtatacaaggtgctgggg
accttcctgtttggggctgccgtgagccagtctctgacagacctggccaagtacatgatt
gggcgtctgaggcccaacttcctagccgtctgcgaccccgactggagccgggtcaactgc
tcggtctatgtgcagctggagaaggtgtgcaggggaaaccctgctgatgtcaccgaggcc
aggttgtctttctactcgggacactcttcctttgggatgtactgcatggtgttcttggcg
ctgtatgtgcaggcacgactctgttggaagtgggcacggctgctgcgacccacagtccag
ttcttcctggtggcctttgccctctacgtgggctacacccgcgtgtctgattacaaacac
cactggagcgatgtccttgttggcctcctgcagggggcactggtggctgccctcactgtc
tgctacatctcagacttcttcaaagcccgacccccacagcactgtctgaaggaggaggag
ctggaacggaagcccagcctgtcactgacgttgaccctgggcgaggctgaccacaaccac
tatggatacccgcactcctcctcctga

KEGG   Homo sapiens (human): 8613Help
Entry
8613              CDS       T01001                                 

Gene name
PLPP3, Dri42, LPP3, PAP2B, PPAP2B, VCIP
Definition
(RefSeq) phospholipid phosphatase 3
  KO
K01080  phosphatidate phosphatase [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04072  Phospholipase D signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04975  Fat digestion and absorption
hsa05231  Choline metabolism in cancer
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8613 (PLPP3)
   00564 Glycerophospholipid metabolism
    8613 (PLPP3)
   00565 Ether lipid metabolism
    8613 (PLPP3)
   00600 Sphingolipid metabolism
    8613 (PLPP3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    8613 (PLPP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8613 (PLPP3)
  09154 Digestive system
   04975 Fat digestion and absorption
    8613 (PLPP3)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8613 (PLPP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     8613 (PLPP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 PAP2_C PAP2_3 Herpes_LMP1
Motif
Other DBs
NCBI-GeneID: 8613
NCBI-ProteinID: NP_003704
OMIM: 607125
HGNC: 9229
Ensembl: ENSG00000162407
Vega: OTTHUMG00000008160
Pharos: O14495(Tbio)
UniProt: O14495
LinkDB All DBs
Position
1p32.2
AA seq 311 aa AA seqDB search
MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIK
PYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN
PYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR
CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFY
TGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVD
IIDRNNHHNMM
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactacaagtacgacaaagcgatcgtcccggagagcaagaacggcggcagcccg
gcgctcaacaacaacccgaggaggagcggcagcaagcgggtgctgctcatctgcctcgac
ctcttctgcctcttcatggcgggcctccccttcctcatcatcgagacaagcaccatcaag
ccttaccaccgagggttttactgcaatgatgagagcatcaagtacccactgaaaactggt
gagacaataaatgacgctgtgctctgtgccgtggggatcgtcattgccatcctcgcgatc
atcacgggggaattctaccggatctattacctgaagaagtcgcggtcgacgattcagaac
ccctacgtggcagcactctataagcaagtgggctgcttcctctttggctgtgccatcagc
cagtctttcacagacattgccaaagtgtccatagggcgcctgcgtcctcacttcttgagt
gtctgcaaccctgatttcagccagatcaactgctctgaaggctacattcagaactacaga
tgcagaggtgatgacagcaaagtccaggaagccaggaagtccttcttctctggccatgcc
tccttctccatgtacactatgctgtatttggtgctatacctgcaggcccgcttcacttgg
cgaggagcccgcctgctccggcccctcctgcagttcaccttgatcatgatggccttctac
acgggactgtctcgcgtatcagaccacaagcaccatcccagtgatgttctggcaggattt
gctcaaggagccctggtggcctgctgcatagttttcttcgtgtctgacctcttcaagact
aagacgacgctctccctgcctgcccctgctatccggaaggaaatcctttcacctgtggac
attattgacaggaacaatcaccacaacatgatgtag

DBGET integrated database retrieval system