KEGG   Homo sapiens (human): 8620
Entry
8620              CDS       T01001                                 

Gene name
NPFF, FMRFAL
Definition
(RefSeq) neuropeptide FF-amide peptide precursor
  KO
K05247  neuropeptide FF-amide peptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8620 (NPFF)
SSDB
Motif
Pfam: NPFF RBM1CTR
Other DBs
NCBI-GeneID: 8620
NCBI-ProteinID: NP_003708
OMIM: 604643
HGNC: 7901
Ensembl: ENSG00000139574
Vega: OTTHUMG00000169856
Pharos: O15130(Tbio)
CPD: C16111 C16112
UniProt: O15130
LinkDB
Position
12q13.13
AA seq 113 aa
MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAM
ERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggattctaggcaggctgctgcactgctggtgctgctgctgttaatagacgggggctgt
gctgaagggccaggaggccagcaggaagaccagctctccgcggaggaagacagcgaaccc
ctcccaccacaggatgcccagacctctgggtcactgttgcactacctgctccaggcaatg
gagagacctggccggagccaagccttcctgtttcagccccagaggtttggcagaaatacc
cagggatcctggaggaatgaatggctgagtccccgggctggagaggggctgaattcccag
ttctggagcctggctgcccctcaacgctttgggaagaagtga

DBGET integrated database retrieval system