KEGG   Homo sapiens (human): 8626Help
Entry
8626              CDS       T01001                                 

Gene name
TP63, AIS, B(p51A), B(p51B), EEC3, KET, LMS, NBP, OFC8, RHS, SHFM4, TP53CP, TP53L, TP73L, p40, p51, p53CP, p63, p73H, p73L
Definition
(RefSeq) tumor protein p63
  KO
K10149  tumor protein p63
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Disease
H00471  Split-hand/foot malformation (SHFM)
H00516  Cleft lip and/or cleft palate
H00638  Ectrodactyly-ectodermal dysplasia cleft-palate syndrome (EEC syndrome)
H00640  Limb-mammary syndrome
H00641  ADULT syndrome
H00752  Ankyloblepharon-ctodermal defects-cleft lip/palate (AEC) syndrome and Rapp-Hodgkin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    8626 (TP63)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    8626 (TP63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer SAM_2 Forkhead_N
Motif
Other DBs
NCBI-GeneID: 8626
NCBI-ProteinID: NP_003713
OMIM: 603273
HGNC: 15979
Ensembl: ENSG00000073282
Vega: OTTHUMG00000156313
Pharos: Q9H3D4(Tbio)
UniProt: Q9H3D4 A0A0S2Z4N5
LinkDB All DBs
Structure
PDB: 

Position
3q28
AA seq 680 aa AA seqDB search
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDARRNKQQRIKEEGE
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaacttcacggtgtgccaccctacagtactgccctgacccttacatccag
cgtttcgtagaaaccccagctcatttctcttggaaagaaagttattaccgatccaccatg
tcccagagcacacagacaaatgaattcctcagtccagaggttttccagcatatctgggat
tttctggaacagcctatatgttcagttcagcccattgacttgaactttgtggatgaacca
tcagaagatggtgcgacaaacaagattgagattagcatggactgtatccgcatgcaggac
tcggacctgagtgaccccatgtggccacagtacacgaacctggggctcctgaacagcatg
gaccagcagattcagaacggctcctcgtccaccagtccctataacacagaccacgcgcag
aacagcgtcacggcgccctcgccctacgcacagcccagctccaccttcgatgctctctct
ccatcacccgccatcccctccaacaccgactacccaggcccgcacagtttcgacgtgtcc
ttccagcagtcgagcaccgccaagtcggccacctggacgtattccactgaactgaagaaa
ctctactgccaaattgcaaagacatgccccatccagatcaaggtgatgaccccacctcct
cagggagctgttatccgcgccatgcctgtctacaaaaaagctgagcacgtcacggaggtg
gtgaagcggtgccccaaccatgagctgagccgtgaattcaacgagggacagattgcccct
cctagtcatttgattcgagtagaggggaacagccatgcccagtatgtagaagatcccatc
acaggaagacagagtgtgctggtaccttatgagccaccccaggttggcactgaattcacg
acagtcttgtacaatttcatgtgtaacagcagttgtgttggagggatgaaccgccgtcca
attttaatcattgttactctggaaaccagagatgggcaagtcctgggccgacgctgcttt
gaggcccggatctgtgcttgcccaggaagagacaggaaggcggatgaagatagcatcaga
aagcagcaagtttcggacagtacaaagaacggtgatggtacgaagcgcccgtttcgtcag
aacacacatggtatccagatgacatccatcaagaaacgaagatccccagatgatgaactg
ttatacttaccagtgaggggccgtgagacttatgaaatgctgttgaagatcaaagagtcc
ctggaactcatgcagtaccttcctcagcacacaattgaaacgtacaggcaacagcaacag
cagcagcaccagcacttacttcagaaacagacctcaatacagtctccatcttcatatggt
aacagctccccacctctgaacaaaatgaacagcatgaacaagctgccttctgtgagccag
cttatcaaccctcagcagcgcaacgccctcactcctacaaccattcctgatggcatggga
gccaacattcccatgatgggcacccacatgccaatggctggagacatgaatggactcagc
cccacccaggcactccctcccccactctccatgccatccacctcccactgcacaccccca
cctccgtatcccacagattgcagcattgtcagtttcttagcgaggttgggctgttcatca
tgtctggactatttcacgacccaggggctgaccaccatctatcagattgagcattactcc
atggatgatctggcaagtctgaaaatccctgagcaatttcgacatgcgatctggaagggc
atcctggaccaccggcagctccacgaattctcctccccttctcatctcctgcggacccca
agcagtgcctctacagtcagtgtgggctccagtgagacccggggtgagcgtgttattgat
gctgtgcgattcaccctccgccagaccatctctttcccaccccgagatgagtggaatgac
ttcaactttgacatggatgctcgccgcaataagcaacagcgcatcaaagaggagggggag
tga

DBGET integrated database retrieval system