KEGG   Homo sapiens (human): 8631Help
Entry
8631              CDS       T01001                                 

Gene name
SKAP1, HEL-S-81p, SCAP1, SKAP55
Definition
(RefSeq) src kinase associated phosphoprotein 1
  KO
K17699  src kinase associated phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    8631 (SKAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH SH3_9 SH3_1 SH3_2 PH_9 PH_11 PH_3 PH_2
Motif
Other DBs
NCBI-GeneID: 8631
NCBI-ProteinID: NP_003717
OMIM: 604969
HGNC: 15605
Ensembl: ENSG00000141293
Vega: OTTHUMG00000178823
Pharos: Q86WV1(Tbio)
UniProt: Q86WV1
LinkDB All DBs
Structure
PDB: 

Position
17q21.32
AA seq 359 aa AA seqDB search
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQG
GDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKD
HSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFEL
TSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDS
PSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQ
GLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgccgccctccctgaggagatccgttggctcctggaagatgctgaagagttt
ctggcagaaggtttgcggaatgagaacctcagcgctgttgcaagggatcacagagaccat
attctacggggctttcagcaaatcaaagccaggtactattgggattttcagccccaaggg
ggagacattggacaggacagctctgatgataatcacagcgggactcttggcctgtccctc
acatccgatgcaccctttttgtcagattatcaggatgagggaatggaagacatcgtaaaa
ggagctcaagaacttgataacgtaatcaagcaaggatacttggagaagaaaagcaaagat
catagtttctttggatcggagtggcagaagcgatggtgtgttgtcagcagaggtctcttc
tactactatgctaatgagaagagcaagcagcccaaagggaccttcctcattaagggctac
ggtgtacggatggccccccacctgcgaagagattccaagaaagaatcctgctttgaactg
acctcccaggataggcgcagctatgagtttacagctactagtccagcagaagccagagac
tgggtggatcaaataagtttcttgttaaaggatctgagctccttaaccattccatatgaa
gaggatgaggaggaagaagaaaaagaagagacatatgatgatattgatggttttgactcc
ccaagttgtggttcccagtgcagacccactatcttgcctgggagtgtggggataaaagag
cctacagaggagaaagaagaagaagatatttatgaagtcttgccagatgaagagcatgat
ctagaagaggatgagagtggcactcgacgaaaaggagtagactatgccagttactaccag
ggcctatgggattgccatggtgaccagccagatgaactgtccttccaacggggtgacctc
atccgtattctgagcaaggagtataacatgtatggctggtgggtgggagaactgaacagc
ctcgttgggattgttccaaaggagtatctcaccactgcctttgaagtggaagaaagatga

DBGET integrated database retrieval system