KEGG   Homo sapiens (human): 8643Help
Entry
8643              CDS       T01001                                 

Gene name
PTCH2, PTC2
Definition
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00895  Basal cell nevus syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    8643 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8643 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    8643 (PTCH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patched Sterol-sensing MMPL
Motif
Other DBs
NCBI-GeneID: 8643
NCBI-ProteinID: NP_003729
OMIM: 603673
HGNC: 9586
Ensembl: ENSG00000117425
Vega: OTTHUMG00000008490
Pharos: Q9Y6C5(Tbio)
UniProt: Q9Y6C5
LinkDB All DBs
Position
1p34.1
AA seq 1203 aa AA seqDB search
MTRSPPLRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
QEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLG
GMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCAQ
SQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTE
ALPGTPLQERMGECLQRTGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTFV
AVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQELGDGTVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKS
LPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
PAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAAHALEHTFAPVTDGAISTLLGLLMLAGSH
FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEILSPPAPQGGG
LRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGP
ATG
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgactcgatcgccgcccctcagagagctgcccccgagttacacacccccagctcgaacc
gcagcaccccagatcctagctgggagcctgaaggctccactctggcttcgtgcttacttc
cagggcctgctcttctctctgggatgcgggatccagagacattgtggcaaagtgctcttt
ctgggactgttggcctttggggccctggcattaggtctccgcatggccattattgagaca
aacttggaacagctctgggtagaagtgggcagccgggtgagccaggagctgcattacacc
aaggagaagctgggggaggaggctgcatacacctctcagatgctgatacagaccgcacgc
caggagggagagaacatcctcacacccgaagcacttggcctccacctccaggcagccctc
actgccagtaaagtccaagtatcactctatgggaagtcctgggatttgaacaaaatctgc
tacaagtcaggagttccccttattgaaaatggaatgattgagcggatgattgagaagctg
tttccgtgcgtgatcctcacccccctcgactgcttctgggagggagccaaactccaaggg
ggctccgcctacctgcccggccgcccggatatccagtggaccaacctggatccagagcag
ctgctggaggagctgggtccctttgcctcccttgagggcttccgggagctgctagacaag
gcacaggtgggccaggcctacgtggggcggccctgtctgcaccctgatgacctccactgc
ccacctagtgcccccaaccatcacagcaggcaggctcccaatgtggctcacgagctgagt
gggggctgccatggcttctcccacaaattcatgcactggcaggaggaattgctgctggga
ggcatggccagagacccccaaggagagctgctgagggcagaggccctgcagagcaccttc
ttgctgatgagtccccgccagctgtacgagcatttccggggtgactatcagacacatgac
attggctggagtgaggagcaggccagcacagtgctacaagcctggcagcggcgctttgtg
cagctggcccaggaggccctgcctgagaacgcttcccagcagatccatgccttctcctcc
accaccctggatgacatcctgcatgcgttctctgaagtcagtgctgcccgtgtggtggga
ggctatctgctcatgctggcctatgcctgtgtgaccatgctgcggtgggactgcgcccag
tcccagggttccgtgggccttgccggggtactgctggtggccctggcggtggcctcaggc
cttgggctctgtgccctgctcggcatcaccttcaatgctgccactacccaggtgctgccc
ttcttggctctgggaatcggcgtggatgacgtattcctgctggcgcatgccttcacagag
gctctgcctggcacccctctccaggagcgcatgggcgagtgtctgcagcgcacgggcacc
agtgtcgtactcacatccatcaacaacatggccgccttcctcatggctgccctcgttccc
atccctgcgctgcgagccttctccctacaggcggccatagtggttggctgcacctttgta
gccgtgatgcttgtcttcccagccatcctcagcctggacctacggcggcgccactgccag
cgccttgatgtgctctgctgcttctccagtccctgctctgctcaggtgattcagatcctg
ccccaggagctgggggacgggacagtaccagtgggcattgcccacctcactgccacagtt
caagcctttacccactgtgaagccagcagccagcatgtggtcaccatcctgcctccccaa
gcccacctggtgcccccaccttctgacccactgggctctgagctcttcagccctggaggg
tccacacgggaccttctaggccaggaggaggagacaaggcagaaggcagcctgcaagtcc
ctgccctgtgcccgctggaatcttgcccatttcgcccgctatcagtttgccccgttgctg
ctccagtcacatgctaaggccatcgtgctggtgctctttggtgctcttctgggcctgagc
ctctacggagccaccttggtgcaagacggcctggccctgacggatgtggtgcctcggggc
accaaggagcatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggcc
ctggtgacccagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggcggtgctgcccccaccggccacccaggcaccccgcacc
tggctgcactattaccgcaactggctacagggaatccaggctgcctttgaccaggactgg
gcttctgggcgcatcacccgccactcgtaccgcaatggctctgaggatggggccctggcc
tacaagctgctcatccagactggagacgcccaggagcctctggatttcagccagctgacc
acaaggaagctggtggacagagagggactgattccacccgagctcttctacatggggctg
accgtgtgggtgagcagtgaccccctgggtctggcagcctcacaggccaacttctacccc
ccacctcctgaatggctgcacgacaaatacgacaccacgggggagaaccttcgcatcccg
ccagctcagcccttggagtttgcccagttccccttcctgctgcgtggcctccagaagact
gcagactttgtggaggccatcgagggggcccgggcagcatgcgcagaggccggccaggct
ggggtgcacgcctaccccagcggctcccccttcctcttctgggaacagtatctgggcctg
cggcgctgcttcctgctggccgtctgcatcctgctggtgtgcactttcctcgtctgtgct
ctgctgctcctcaacccctggacggctggcctcatagtgctggtcctggcgatgatgaca
gtggaactctttggtatcatgggtttcctgggcatcaagctgagtgccatccccgtggtg
atccttgtggcctctgtaggcattggcgttgagttcacagtccacgtggctctgggcttc
ctgaccacccagggcagccggaacctgcgggccgcccatgcccttgagcacacatttgcc
cccgtgaccgatggggccatctccacattgctgggtctgctcatgcttgctggttcccac
tttgacttcattgtaaggtacttctttgcggcgctgacagtgctcacgctcctgggcctc
ctccatggactcgtgctgctgcctgtgctgctgtccatcctgggcccgccgccagaggtg
atacagatgtacaaggaaagcccagagatcctgagtccaccagctccacagggaggcggg
cttaggtggggggcatcctcctccctgccccagagctttgccagagtgactacctccatg
accgtggccatccacccaccccccctgcctggtgcctacatccatccagcccctgatgag
cccccttggtcccctgctgccactagctctggcaacctcagttccaggggaccaggtcca
gccactgggtga

DBGET integrated database retrieval system