KEGG   Homo sapiens (human): 8667Help
Entry
8667              CDS       T01001                                 

Gene name
EIF3H, EIF3S3, eIF3-gamma, eIF3-p40
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit H
  KO
K03247  translation initiation factor 3 subunit H
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8667 (EIF3H)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    8667 (EIF3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8667 (EIF3H)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8667 (EIF3H)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    8667 (EIF3H)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   8667 (EIF3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JAB NHS
Motif
Other DBs
NCBI-GeneID: 8667
NCBI-ProteinID: NP_003747
OMIM: 603912
HGNC: 3273
Ensembl: ENSG00000147677
Vega: OTTHUMG00000164919
Pharos: O15372(Tbio)
UniProt: O15372 Q6IB98
LinkDB All DBs
Structure
PDB: 

Position
8q23.3-q24.11
AA seq 352 aa AA seqDB search
MASRKEGTGSTATSSSSTAGAAGKGKGKGGSGDSAVKQVQIDGLVVLKIIKHYQEEGQGT
EVVQGVLLGLVVEDRLEITNCFPFPQHTEDDADFDEVQYQMEMMRSLRHVNIDHLHVGWY
QSTYYGSFVTRALLDSQFSYQHAIEESVVLIYDPIKTAQGSLSLKAYRLTPKLMEVCKEK
DFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLG
KNLQLLMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPPLPEED
LSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccgcaaggaaggtaccggctctactgccacctcttccagctccaccgccggc
gcagcagggaaaggcaaaggcaaaggcggctcgggagattcagccgtgaagcaagtgcag
atagatggccttgtggtattaaagataatcaaacattatcaagaagaaggacaaggaact
gaagttgttcaaggagtgcttttgggtctggttgtagaagatcggcttgaaattaccaac
tgctttcctttccctcagcacacagaggatgatgctgactttgatgaagtccaatatcag
atggaaatgatgcggagccttcgccatgtaaacattgatcatcttcacgtgggctggtat
cagtccacatactatggctcattcgttacccgggcactcctggactctcagtttagttac
cagcatgccattgaagaatctgtcgttctcatttatgatcccataaaaactgcccaagga
tctctctcactaaaggcatacagactgactcctaaactgatggaagtttgtaaagaaaag
gatttttcccctgaagcattgaaaaaagcaaatatcacctttgagtacatgtttgaagaa
gtgccgattgtaattaaaaattcacatctgatcaatgtcctaatgtgggaacttgaaaag
aagtcagctgttgcagataaacatgaattgctcagccttgccagcagcaatcatttgggg
aagaatctacagttgctgatggacagagtggatgaaatgagccaagatatagttaaatac
aacacatacatgaggaatactagtaaacaacagcagcagaaacatcagtatcagcagcgt
cgccagcaggagaatatgcagcgccagagccgaggagaacccccgctccctgaggaggac
ctgtccaaactcttcaaaccaccacagccgcctgccaggatggactcgctgctcattgca
ggccagataaacacttactgccagaacatcaaggagttcactgcccaaaacttaggcaag
ctcttcatggcccaggctcttcaagaatacaacaactaa

DBGET integrated database retrieval system