KEGG   Homo sapiens (human): 8673
Entry
8673              CDS       T01001                                 

Gene name
VAMP8, EDB, VAMP-8
Definition
(RefSeq) vesicle associated membrane protein 8
  KO
K08512  vesicle-associated membrane protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04140  Autophagy - animal
hsa04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8673 (VAMP8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8673 (VAMP8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8673 (VAMP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8673 (VAMP8)
Membrane trafficking [BR:hsa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    8673 (VAMP8)
SSDB
Motif
Pfam: Synaptobrevin Ferlin_C MCU Orf78 Baculo_F Prominin TMCO5 Peptidase_M56 EVI2A E1-E2_ATPase DUF2721 ODV-E18 Stevor DUF2207 TSKS Sigma_reg_N
Other DBs
NCBI-GeneID: 8673
NCBI-ProteinID: NP_003752
OMIM: 603177
HGNC: 12647
Ensembl: ENSG00000118640
Vega: OTTHUMG00000130180
Pharos: Q9BV40(Tbio)
UniProt: Q9BV40
LinkDB
Structure
PDB: 
4WY4

Position
2p11.2
AA seq 100 aa
MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKT
TSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS
NT seq 303 nt   +upstreamnt  +downstreamnt
atggaggaagccagtgaaggtggaggaaatgatcgtgtgcggaacctgcaaagtgaggtg
gagggagttaagaatattatgacccagaatgtggagcggatcctggcccggggggaaaac
ttggaacatctccgcaacaagacagaggatctggaagccacatctgagcacttcaagacg
acatcgcagaaggtggctcgaaaattctggtggaagaacgtgaagatgattgtccttatc
tgcgtgattgtttttatcatcatcctcttcattgtgctctttgccactggtgccttctct
taa

DBGET integrated database retrieval system