KEGG   Homo sapiens (human): 8681Help
Entry
8681              CDS       T01001                                 

Gene name
JMJD7-PLA2G4B, HsT16992, cPLA2-beta
Definition
(RefSeq) JMJD7-PLA2G4B readthrough
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8681 (JMJD7-PLA2G4B)
   00565 Ether lipid metabolism
    8681 (JMJD7-PLA2G4B)
   00590 Arachidonic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00591 Linoleic acid metabolism
    8681 (JMJD7-PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    8681 (JMJD7-PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8681 (JMJD7-PLA2G4B)
   04010 MAPK signaling pathway
    8681 (JMJD7-PLA2G4B)
   04370 VEGF signaling pathway
    8681 (JMJD7-PLA2G4B)
   04072 Phospholipase D signaling pathway
    8681 (JMJD7-PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8681 (JMJD7-PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8681 (JMJD7-PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    8681 (JMJD7-PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    8681 (JMJD7-PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    8681 (JMJD7-PLA2G4B)
   04913 Ovarian steroidogenesis
    8681 (JMJD7-PLA2G4B)
   04921 Oxytocin signaling pathway
    8681 (JMJD7-PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8681 (JMJD7-PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    8681 (JMJD7-PLA2G4B)
   04726 Serotonergic synapse
    8681 (JMJD7-PLA2G4B)
   04730 Long-term depression
    8681 (JMJD7-PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8681 (JMJD7-PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8681 (JMJD7-PLA2G4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8681 (JMJD7-PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 8681
NCBI-ProteinID: NP_001185517
HGNC: 34449
Ensembl: ENSG00000168970
Vega: OTTHUMG00000044442
Pharos: P0C869(Tchem)
UniProt: P0C869
LinkDB All DBs
Position
15q15.1
AA seq 893 aa AA seqDB search
MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQH
WPALQKWSLPYFRATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRA
QHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALGKMPDAVNFWLGEAAAVTSLHKD
HYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKAEVSRT
CLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVWNQSFHFRIH
RQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEGRLEVEFRLQ
SLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGPQEASVGTGT
FRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMRVELKKEAGL
RELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIMATGGGIRAM
TSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTELLKTQVTKN
KLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLSDQREALSHG
QNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFFMGQLMKRL
PESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPLLKIEEPPST
AGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGLPNQLTPSEP
HLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQGSGGHPRRRQLGR
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggctttggaagccgtgcggagcgagttacgagaattcccggccgctgca
agggagctctgcgtgcctcttgctgtgccctacctggacaaacccccaactccgctccac
ttctaccgggactgggtctgccccaacaggccgtgcattatccgcaacgctctgcagcac
tggccggccctccagaagtggtccctcccctatttcagagccacagtgggctccacagag
gtgagtgtggccgtgaccccagatggttacgcggatgccgtgagaggggatcgcttcatg
atgccagctgagcgccgcctgcccctgagcttcgtgctggatgtgctggagggccgggcc
cagcaccctggagtcctctatgtgcagaagcagtgctccaacctgcccagcgagctgccc
cagctgctgcctgatctggaatcccatgtgccctgggcctccgaagccctgggaaagatg
cccgatgctgtgaacttctggctgggggaggcggctgcagtgacttctttgcacaaggac
cactatgagaacctctactgcgtggtctcaggagagaagcatttcctgttccatccgccc
agcgaccggcccttcatcccctatgagctgtacacgccggcaacctaccagctaactgaa
gagggcacctttaaggtggtggatgaagaggccatggagaaggcagaggtgtccaggacc
tgcctgctcacggttcgtgtcctgcaggcccatcgcctaccctctaaggacctagtgacc
ccctctgactgctacgtgactctctggctgcccacggcctgcagccacaggctccagaca
cgcacggtcaagaacagcagtagccctgtctggaaccagagctttcacttcaggatccac
aggcagctcaagaatgtcatggaactgaaagtctttgaccaggacctggtgaccggagat
gaccctgtgttgtcagtactgtttgatgcggggactctgcgggctggggagttccggcgc
gagagcttctcactgagccctcagggtgaggggcgcctggaagttgaatttcgcctgcag
agtctggctgaccgtggcgagtggctcgtcagcaatggcgttctggtggcccgggagctc
tcctgcttgcacgttcaactggaggagacaggagaccagaagtcctcagagcacagagtt
cagcttgtggttcctgggtcctgtgagggtccgcaggaggcctctgtgggcactggcacc
ttccgcttccactgcccagcctgctgggagcaggagctgagtattcgcctgcaggatgcc
cccgaggagcaactaaaggcgccactgagtgccctgccctctggtcaagtggtgaggctt
gtcttccccacgtcccaggagcccctgatgagagtggagctgaaaaaagaagcaggactg
agggagctggccgtgcgactgggcttcgggccctgtgcagaggagcaggccttcctgagc
aggaggaagcaggtggtggccgcggccttgaggcaggccctgcagctggacggagacctg
caggaggatgagatcccagtggtagctattatggccactggtggtgggatccgggcaatg
acttccctgtatgggcagctggctggcctgaaggagctgggcctcttggattgcgtctcc
tacatcaccggggcctcgggctccacctgggccttggccaacctttatgaggacccagag
tggtctcagaaggacctggcagggcccactgagttgctgaagacccaggtgaccaagaac
aagctgggtgtgctggcccccagccagctgcagcggtaccggcaggagctggccgagcgt
gcccgcttgggctacccaagctgcttcaccaacctgtgggccctcatcaacgaggcgctg
ctgcatgatgagccccatgatcacaagctctcagatcaacgggaggccctgagtcatggc
cagaaccctctgcccatctactgtgccctcaacaccaaagggcagagcctgaccactttt
gaatttggggagtggtgcgagttctctccctacgaggtcggcttccccaagtacggggcc
ttcatcccctctgagctctttggctccgagttctttatggggcagctgatgaagaggctt
cctgagtcccgcatctgcttcttagaaggtatctggagcaacctgtatgcagccaacctc
caggacagcttatactgggcctcagagcccagccagttctgggaccgctgggtcaggaac
caggccaacctggacaaggagcaggtcccccttctgaagatagaagaaccaccctcaaca
gccggcaggatagctgagtttttcaccgatcttctgacgtggcgtccactggcccaggcc
acacataatttcctgcgtggcctccatttccacaaagactactttcagcatcctcacttc
tccacatggaaagctaccactctggatgggctccccaaccagctgacaccctcggagccc
cacctgtgcctgctggatgttggctacctcatcaataccagctgcctgcccctcctgcag
cccactcgggacgtggacctcatcctgtcattggactacaacctccacggagccttccag
gggtccggcggacacccgaggaggcggcagctggggaggtga

DBGET integrated database retrieval system