KEGG   Homo sapiens (human): 8701
Entry
8701              CDS       T01001                                 

Gene name
DNAH11, CILD7, DNAHBL, DNAHC11, DNHBL, DPL11
Definition
(RefSeq) dynein axonemal heavy chain 11
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Disease
H00564  Primary ciliary dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    8701 (DNAH11)
   05016 Huntington disease
    8701 (DNAH11)
   05022 Pathways of neurodegeneration - multiple diseases
    8701 (DNAH11)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     8701 (DNAH11)
SSDB
Motif
Pfam: DHC_N1 MT AAA_6 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 AAA_lid_1 Dynein_heavy Dynein_AAA_lid AAA_5 AAA_16 AAA_22 AAA AAA_30 Laminin_II FAM177 AAA_25
Other DBs
NCBI-GeneID: 8701
NCBI-ProteinID: NP_001264044
OMIM: 603339
HGNC: 2942
Ensembl: ENSG00000105877
Vega: OTTHUMG00000152524
Pharos: Q96DT5(Tbio)
UniProt: Q96DT5 H9NAJ7 Q96NT7 H9NAJ8
LinkDB
Position
7p15.3
AA seq 4516 aa
MAAQVAAREARDFREAPTLRLTSGAGLEAVGAVELEEEEENEEEAAARRARSFAQDARVR
FLGGRLAMMLGFTEEKWSQYLESEDNRQVLGEFLESTSPACLVFSFAASGRLAASQEIPR
DANHKLVFISKKITESIGVNDFSQVVLFGELPALSLGHVSAFLDEILVPVLSNKNNHKSW
SCFTSQDMEYHIEVMKKKMYIFRGKMSRRTLLPIPTVAGKMDLDQNCSENKPPSNERIIL
HAIESVVIEWSHQIQEIIERDSVQRLLNGLHLSPQAELDFWMMRRENLSCIYDQLQAPVV
LKMVKILTTKQSSYFPTLKDIFLAVENALLEAQDVELYLRPLRRHIQCLQETEFPQTRIL
IAPLFHTICLIWSHSKFYNTPARVIVLLQEFCNLFINQATAYLSPEDLLRGEIEESLEKV
QVAVNILKTFKNSFFNYRKKLASYFMGRKLRPWDFQSHLVFCRFDKFLDRLIKIEDIFAT
TLEFEKLERLEFGGTKGAILNGQVHEMSEELMELCKLFKQSTYDPSDCTNMEFESDYVAF
KSKTLEFDRRLGTIICEAFFNCNGLEAAFKLLTIFGNFLEKPVVMEIFSLHYSTLVHMFN
TELDVCKQLYNEHMKQIECGHVVLNKNMPFTSGNMKWAQQVLQRLQMFWSNFASLRYLFL
GNPDHALVYQKYVEMTTLLDQFESRIYNEWKSNVDEICEFNLNQPLVKFSAINGLLCVNF
DPKLVAVLREVKYLLMLKKQDIPDSALAIFKKRNTILKYIGNLDLLVQGYNKLKQTLLEV
EYPLIEDELRAIDEQLTAATTWLTWQDDCWGYIERVRAATSELEHRVERTQKNVKVIQQT
MRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPS
LDTWKIYVEFIDDIVVEGFFQAIMHDLDFFLKNTEKQLKPAPFFQAQMILLPPEIVFKPS
LDREAGDGFYDLVEEMLCNSFRMSAQMNRIATHLEIKNYQNDMDNMLGLAEVRQEIMNRV
VNVINKVLDFRNTLETHTYLWVDDRAEFMKHFLLYGHAVSSDEMDAHANEEIPEQPPTLE
QFKEQIDIYEALYVQMSKFEDFRVFDSWFKVDMKPFKVSLLTIIKKWSWMFQEHLLRFVI
DSLNELQEFIKETDSGLQRELNEGDHDGLVDIMVHLLAVRSRQRATDELFEPLKETITLL
ESYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLHNAEVTLIRKKCILFDAKQAE
FRERFRHYAPLGFNAENPYTALDKANEELEALEEEMLQMQESTRLFEVALPEYKQMKQCR
KEIKLLKGLWDVIIYVRRSIDNWTKTQWRQIHVEQMDVELRRFAKEIWSLNKEVRVWDAY
TGLEGTVKDMTASLRAITELQSPALRDRHWHQLMKAIGVKFLINEATTLADLLALRLHRV
EDDVRRIVDKAVKELGTEKVITEISQTWATMKFSYEVHYRTGIPLLKSDEQLFETLEHNQ
VQLQTLLQSKYVEYFIEQVLSWQNKLNIADLVIFTWMEVQRTWSHLESIFVCSEDIRIQL
VKDARRFDGVDAEFKELMFKTAKVENVLEATCRPNLYEKLKDLQSRLSLCEKALAEYLET
KRIAFPRFYFVSSADLLDILSKGAQPKQVTCHLAKLFDSIADLQFEDNQDVSAHRAVGMY
SKEKEYVPFQAECECVGHVETWLLQLEQTMQETVRHSITEAIVAYEEKPRELWIFDFPAQ
VALTSSQIWWTTDVGIAFSRLEEGYETALKDFHKKQISQLNTLITLLLGELPPGDRQKIM
TICTIDVHARDVVAKLISQKVVSPQAFTWLSQLRHRWEDTQKHCFVNICDAQFQYFYEYL
GNSPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGMMVYVFNCS
EQMDYKSIGNIYKGLVQTGAWGCFDEFNRISVEVLSVVAVQVKMIHDAIRNRKKRFVFLG
EAITLKPSVGIFITMNPGYAGRTELPENLKALFRPCAMVAPDIELICEILLVAEGFVDAR
ALARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDKNRPEDQVLMRALRDF
NMPKIVTDDIPVFLGLVGDLFPALDVPRRRKLHFEQMVRQSTLELRLQPEESFILKVVQL
EELLAVRHSVFVVGNAGTGKSKILRTLNRTYVNMKQKPVWNDLNPKAVTTDELFGFIHHA
TREWKDGKIVYSYFIGLFSSILREQANLKHDGPKWIVLDGDIDPMWIESLNTVMDDNKVL
TLASNERIALTPFMRLLFEIHHLRSATPATVSRAGILYVNPQDLGWNPYVASWIDRRRHQ
SEKANLTILFDKYVPACLDKLRTSFKTITSIPESSLVQTLCVLLECLLTPENVPSDSPKE
VYEVYFVFACIWAFGGTLLQDQISDYQADFSRWWQKEMKAVKFPSQGTIFDYYVDHKTKK
LLPWADKIAQFTMDPDVPLQTVLVHTTETARLRYFMELLLEKGKPLMLVGNAGVGKTVFV
GDTLASLSEDYIVSRVPFNYYTTSTALQKILEKPLEKKAGHNYGPGGNKKLIYFIDDMNM
PEVDLYGTVQPHTLIRQHIDYGHWYDRQKVMLKEIHNCQYVACMNPMVGSFTINPRLQRH
FTVFAFNFPSLDALNTIYGQIFSFHFQQQAFAPSILRSGPTLIQATIAFHQTMMCNFLPT
AIKFHYIFNLRDLSNVFQGILFASPECLKGPLDLIHLWLHESARVYGDKLIDKKDCDLFQ
RRMLETAYKYFEGIDSHMLLQQPLIYCHFADRGKDPHYMPVKDWEVLKTILTETLDNYNE
LNAAMHLVLFEDAMQHVCRISRILRTPQGCALLVGVGGSGKQSLSRLAAYLRGLEVFQIT
LTEGYGIQELRVDLANLYIRTGAKNMPTVFLLTDAQVLDESFLVLINDLLASGEIPDLFS
DEDVDKIISGIHNEVHALGMVDSRENCWKFFMARVRLQLKIILCFSPVGRTLRVRARKFP
AIVNCTAIDWFHAWPQEALVSVSRRFIEETKGIEPVHKDSISLFMAHVHTTVNEMSTRYY
QNERRHNYTTPKSFLEQISLFKNLLKKKQNEVSEKKERLVNGIQKLKTTASQVGDLKARL
ASQEAELQLRNHDAEALITKIGLQTEKVSREKTIADAEERKVTAIQTEVFQKQRECEADL
LKAEPALVAATAALNTLNRVNLSELKAFPNPPIAVTNVTAAVMVLLAPRGRVPKDRSWKA
AKVFMGKVDDFLQALINYDKEHIPENCLKVVNEHYLKDPEFNPNLIRTKSFAAAGLCAWV
INIIKFYEVYCDVEPKRQALAQANLELAAATEKLEAIRKKLVDLDRNLSRLTASFEKATA
EKVRCQEEVNQTNKTIKLANRLVKELEAKKIRWGQSIKSFEAQEKTLCGDVLLTAAFVSY
VGPFTRQYRQELVHCKWVPFLQQKVSIPLTEGLDLISMLTDDATIAAWNNEGLPSDRMST
ENAAILTHCERWPLVIDPQQQGIKWIKNKYGMDLKVTHLGQKGFLNAIETALAFGDVILI
ENLEETIDPVLDPLLGRNTIKKGKYIRIGDKECEFNKNFRLILHTKLANPHYKPELQAQT
TLLNFTVTEDGLEAQLLAEVVSIERPDLEKLKLVLTKHQNDFKIELKYLEDDLLLRLSAA
EGSFLDDTKLVERLEATKTTVAEIEHKVIEAKENERKINEARECYRPVAARASLLYFVIN
DLQKINPLYQFSLKAFNVLFHRAIEQADKVEDMQGRISILMESITHAVFLYTSQALFEKD
KLTFLSQMAFQILLRKKEIDPLELDFLLRFTVEHTHLSPVDFLTSQSWSAIKAIAVMEEF
RGIDRDVEGSAKQWRKWVESECPEKEKLPQEWKKKSLIQKLILLRAMRPDRMTYALRNFV
EEKLGAKYVERTRLDLVKAFEESSPATPIFFILSPGVDALKDLEILGKRLGFTIDSGKFH
NVSLGQGQETVAEVALEKASKGGHWVILQNVHLVAKWLGTLEKLLERFSQGSHRDYRVFM
SAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFDQDTLEICSKEQEFKSI
LFSLCYFHACVAGRLRFGPQGWSRSYPFNPGDLTICASVLYNYLEANSKVPWEDLRYLFG
EIMYGGHITDDWDRKLCRVYLEEFMNPSLTEDELMLAPGFAAPPYLDYAGYHQYIEEMLP
PESPALYGLHPNAEIEFLTVTSNTLFRTLLEMQPRNALSGDELGQSTEEKVKNVLDDILE
KLPEEFNMAEIMQKNSNRSPYVLVCFQECERMNILIREIRISLEQLDLSLKGELALSPAV
EAQQFALSYDTVPDTWSKLAYPSTYGLAQWFNDLLLRCRELDTWTQDLTLPAVVWLSGFF
NPQSFLTAIMQTMARKNEWPLDKTRLTADVTKKTKEDYGHPPREGAYLHGLFMEGARWDT
QAGTIVEARLKELACPMPVIFAKATPVDRQETKQTYECPVYRTKLRGPSYIWTFRLKSEE
KTAKWVLAGVALLLEA
NT seq 13551 nt   +upstreamnt  +downstreamnt
atggcagcccaggtggcagcccgggaggcgcgagacttcagagaagccccgacccttcgc
ctaacctcgggggccggcctggaggcagtgggcgctgtggagctcgaggaggaggaggag
aacgaggaggaggcggcggccaggagagcgcggagtttcgcccaagacgcgcgggtgcgc
ttcctcggcggccgcctggcgatgatgctggggttcacggaggagaaatggagccagtat
ttggaaagcgaggacaaccggcaggttcttggggagtttctggaaagcaccagcccggct
tgccttgtgtttagcttcgccgcctcggggcgccttgcggcttcccaggagattccaaga
gatgcaaaccataaacttgtttttatttccaagaagattactgaaagcattggagtaaat
gacttttctcaagtggttttatttggagagttacctgcgttgtctcttggacatgtatct
gctttccttgatgagattttagtgccagttctttctaataagaacaaccataagtcctgg
tcctgttttacttcacaagatatggaatatcacatagaagtcatgaaaaagaagatgtat
atttttaggggcaaaatgtctagaagaactcttctaccaattcccactgttgcaggaaag
atggatctggatcagaattgttcagagaacaagccaccgtcaaacgaaaggataatactt
catgcaattgaatctgtggttattgaatggtcacatcaaatccaagaaattatagaaaga
gattcagtgcagcgtttgttgaatggtcttcacttgtctcctcaagcagaactagatttc
tggatgatgaggagagaaaatctgtcatgcatttatgatcaacttcaggcacctgttgtc
ctcaaaatggttaagatcctgacaactaaacaaagcagctattttcctactctgaaggac
atttttctggctgtggaaaatgctcttctcgaagcccaagatgtggaactttacctgaga
cctctgaggagacacatccagtgtctccaggagacggaattcccacagacacgcatatta
atcgctccattatttcataccatctgtctgatctggagtcattccaagttttataacacc
ccagctcgggttatagttttattgcaagagttttgtaatctcttcattaaccaggcaaca
gcttacctttcacctgaggaccttttgaggggagaaatagaagagtcactggaaaaggtg
caggtggctgttaacatcttaaagactttcaaaaactcctttttcaactatagaaaaaaa
ttggcaagctactttatgggaagaaagctgagaccatgggatttccagtctcatctggtg
ttttgcagatttgacaagtttcttgatcgtttaataaaaatagaggatatatttgccacc
actttggaatttgaaaagctggaaagactggaatttggtggtaccaaaggagcaatttta
aatggacaagtccacgagatgagtgaagaacttatggaactctgtaaactttttaaacag
agcacttatgacccatctgattgcactaacatggagtttgaaagtgattatgtggcattt
aagtccaaaactctggaatttgacagaaggcttgggacaattatttgtgaagctttcttt
aactgcaatggcttagaagctgcatttaagcttttgaccatatttggaaattttctagag
aagccagttgtcatggaaattttcagcctacattacagcacactagtgcatatgtttaat
acagagctggatgtgtgtaagcaactgtataatgaacacatgaaacagattgaatgtggt
catgtagttcttaacaagaacatgccatttacctcaggaaatatgaaatgggcccagcag
gttctccaacgacttcaaatgttttggtcaaacttcgcatctctccgttatctatttttg
ggcaatcctgatcacgctttagtttatcaaaagtatgttgaaatgaccactttgcttgat
caatttgaaagtcgtatctataatgaatggaaaagtaatgtggatgaaatctgtgaattc
aatttgaatcaacccttggttaaattcagtgccataaatggtcttctctgtgtcaatttt
gacccaaagctagtggctgtattgagagaagtgaaatatcttttgatgttgaagaaacaa
gacataccagattcagctttagccatcttcaagaaaaggaacactattttaaagtacatt
ggaaatcttgaccttcttgtgcaagggtataataaactcaaacagacgctcctggaagtt
gaataccctctgattgaagatgagctgagggctattgacgagcagctgacagcagccaca
acgtggctgacatggcaggatgactgctggggctacatcgagagggtgagggcagccacg
tccgagttggagcacagagttgagcgcacacagaaaaacgtgaaggtgatccagcagacc
atgaggggctgggccaggtgcgtgctacctcccaggagagagcacagacgagaggcagcc
ttcaccttggaggacaagggtgatttgtttacaaaaaaatacaagttaatccaaggagat
ggctgcaagatccacaacttggtcgaggaaaataggaagctcttcaaagccaatccctct
ctggatacctggaaaatttatgtagaattcattgacgacattgtggtggaaggctttttt
caggctataatgcacgacttagacttctttctgaagaatacagagaaacaattgaaaccg
gcaccgttttttcaagcacaaatgatcttgttgcctcctgagattgtgtttaaaccttcc
ctagacagagaggctggggatggcttctatgatcttgtagaagaaatgttatgcaatagt
tttagaatgtctgcccagatgaaccgaatagcaacacacctggaaattaaaaattatcag
aatgatatggataacatgttaggcctggcagaggtcaggcaggagatcatgaacagagtg
gtgaatgtcatcaacaaagtcttagatttcagaaacaccctggagacccacacttacctc
tgggtggatgatcgagctgagtttatgaagcattttctcttgtatggccatgctgtgtct
tccgatgaaatggatgctcatgcaaatgaagaaattcccgaacaaccaccaactcttgag
caattcaaagaacagattgacatttatgaagctttgtatgttcaaatgagcaaatttgag
gactttagagtgtttgatagttggttcaaggtggacatgaagcctttcaaagtgagcttg
ttaaccataattaagaaatggagctggatgtttcaggagcatcttttgagatttgtcatt
gacagtctgaatgagctacaagaatttataaaggagacagattccggacttcagagagaa
ttaaatgaaggtgatcatgatggtttagttgacatcatggtgcatcttctggctgtaaga
agccgacagagagctactgatgaactctttgaacctctaaaagaaacgatcaccctcttg
gaaagctatggccagaagatgcctgagcaggtctatattcagctagaggaattacctgaa
agatgggaaactaccaaaaagatcgcagcaactgtcagacatgaagtctcacctctccat
aatgcggaagtcactcttataaggaaaaaatgtattttgtttgacgcaaagcaggcagag
ttcagagagagattcagacactatgcccctcttggatttaatgcagaaaatccatacaca
gcgcttgataaggcaaatgaagagcttgaggccttagaagaagaaatgttgcagatgcaa
gaatctactcgtctttttgaagtggctcttccagagtacaaacaaatgaaacagtgtcgc
aaagaaataaaattgctcaagggactgtgggatgtcattatttatgttcgaagaagcatt
gataattggactaaaacccagtggagacagattcatgtggaacagatggatgtagaactc
agaaggtttgccaaggaaatttggtcactcaacaaggaagtccgcgtctgggatgcttac
acgggcctggaaggcacagttaaggacatgacagcctccctgagggccatcacagagtta
cagagccctgccctcagggacaggcattggcaccagctgatgaaagctattggggtcaag
tttttaataaatgaagccacaactttggcagatttgttagcactgcggttacacagagtg
gaagatgatgtccgaaggattgtggacaaggcggtgaaagagctggggactgagaaggtt
attactgaaatcagtcagacctgggcaaccatgaagttttcttacgaagttcactatcga
acaggcattccattactaaagtctgatgaacaactttttgaaactctagagcacaaccaa
gttcagttgcagactcttcttcaaagcaagtatgtagaatatttcattgagcaagtgtta
agctggcaaaataaattaaacatagcagacttggtcatcttcacttggatggaagtccag
cgaacttggtctcacctggaaagcatttttgtctgttcagaagatattcgaatccagctt
gtgaaagatgctagaagatttgatggggtggatgctgaatttaaggagttaatgttcaag
acagccaaagtagaaaatgtgttagaagcaacgtgcagacctaatctctatgaaaaactt
aaagatttacagtccaggctttctctttgtgaaaaagctctcgctgaatacctggaaacc
aagcgcatagcctttcctcgcttctatttcgtctcttctgctgatttacttgacattctc
tcaaaaggagctcagcctaaacaggtaacatgtcaccttgccaaacttttcgacagcatt
gcagatctgcagtttgaagacaatcaggatgtttctgcacacagggcagttggaatgtac
agcaaagaaaaggagtatgtcccattccaagccgagtgtgaatgtgtgggccatgtggaa
acatggcttctgcaacttgaacagactatgcaagaaacggtgcgtcattctataacagaa
gccatagtggcctacgaggaaaaacctagggaactgtggatttttgatttcccagctcag
gttgcactaaccagctcacaaatatggtggaccacagatgtaggaatagccttcagtaga
ctggaagaaggctacgaaacagccctgaaggatttccataaaaaacagatttctcagctg
aatacactgattacacttttgctgggagaacttccacctggagacagacagaagatcatg
acaatttgtaccatagatgtccatgccagagacgtggtggcaaaacttatttctcagaag
gttgtcagtccccaagcttttacatggctgtctcaacttcgtcaccgatgggaggatacc
cagaaacactgctttgttaatatttgtgatgcccagttccagtacttctatgaatactta
ggaaacagccctcgactagtgatcactcctctaactgacaggtgttatattaccttaact
caatcacttcatctaaccatgagtggggctcctgctggcccagctggtaccgggaaaaca
gagaccaccaaagacctaggacgtgcccttggcatgatggtctatgtattcaactgttca
gagcaaatggactacaaatccataggcaatatctataagggattggtgcagacaggagct
tggggctgctttgatgagttcaaccgaatctctgtggaagttctgtcagtggtggcagta
caagtgaaaatgattcatgatgccatcagaaacaggaagaagagatttgtatttcttggg
gaagctatcacactgaagccatcagttggaatatttattactatgaacccgggttatgct
ggtcgaaccgaattaccggaaaatctcaaagctcttttcagaccctgtgccatggtggcc
cctgacattgagctaatctgtgaaatcttgttagttgctgaaggttttgtggatgcgcgt
gcattagcccgaaagttcattacgttgtacacgctttgcaaggagcttctctccaagcag
gatcattacgactggggacttcgtgctattaagtctgtcttggttgtggctggatctctg
aaacgaggagataaaaatagacccgaagatcaggtactcatgagagcattaagggatttc
aatatgcccaaaatagtgactgacgacatcccagtgtttctgggcctggtcggtgacctg
tttccagccctggatgtgccccggaggaggaagctgcactttgaacagatggtcaggcag
tctaccctggagctccgcctgcagcctgaagagagcttcatcctcaaagttgtccagctt
gaggaactgttggctgtgcggcactcggtctttgtagttggaaatgcaggcacaggaaag
agtaagattttgagaacactgaaccgaacatatgttaacatgaaacagaagccggtttgg
aatgacttaaaccctaaagctgtgacaacagatgaactctttggtttcatacatcatgct
acccgagaatggaaagatggcaagattgtttactcttattttataggtctcttctcatcc
attctacgagaacaagcaaatcttaagcatgatggaccaaaatggatagtcctggatggc
gatattgaccccatgtggattgaatcactgaatactgtaatggatgataacaaggtgctg
accctcgccagcaatgagcgcattgcactcactcccttcatgaggcttctgtttgagata
catcacttaaggagcgcaaccccggccactgtttccagagctggtattctgtatgtgaac
ccacaagatctgggctggaatccgtatgtggccagttggatagacagaaggcggcatcaa
tcagaaaaggccaatttgactattctttttgataaatatgtccctgcatgcttggataaa
ctgagaacaagctttaaaaccatcacttcaattcctgagagtagcctggtgcagactcta
tgtgttcttttggagtgcttgctgactcctgaaaatgtaccttctgacagcccaaaagaa
gtttatgaagtctattttgtatttgcttgtatctgggcttttggaggcaccctgctacaa
gatcagatttctgattatcaagctgacttcagtcggtggtggcagaaagagatgaaagca
gtgaaatttccgtcgcagggaacaatctttgattattatgtggaccacaaaactaagaaa
ttattgccctgggctgacaaaattgcccagtttactatggatccagatgtgcctctgcag
acagttctcgttcacacaacagagacagctcgtcttagatatttcatggagttgttgctt
gagaaaggaaaacctctaatgctagtaggaaatgcaggagtgggaaaaacagtctttgta
ggtgacacattggcaagtctctctgaggattacatagtatcccgtgtgcctttcaactac
tacacgacatccacagctctgcaaaaaattcttgagaaacccctagagaaaaaagctggt
cataactatggtcctggaggaaataaaaaattgatttattttatcgacgacatgaacatg
cctgaagtggacttatatggcaccgttcagcctcacaccctgatccggcagcatattgat
tatggacattggtatgatagacagaaggtgatgcttaaagaaatccataactgccagtat
gtcgcctgcatgaatccgatggtgggcagcttcaccatcaatcccaggctacagagacat
ttcacagtgtttgcattcaattttccatctttggatgcactaaacaccatctatggccaa
atctttagcttccatttccaacagcaagcatttgctccatcaattctcaggagtggcccc
actttgatccaggcaacaatagcattccatcagacaatgatgtgtaactttttacccacg
gctattaaattccactacatctttaatctgagagatttatcaaacgtcttccaggggatt
ttatttgcttctcctgagtgtttaaaaggtccacttgatttaatacatctgtggcttcat
gaatctgcccgtgtttatggagacaaactgatagacaaaaaagattgtgatttgtttcag
agaagaatgctggaaactgcttataaatattttgaaggtatagatagtcacatgctgctt
caacagcccctcatttattgccactttgctgatagagggaaggacccacattacatgcca
gtgaaggactgggaagtgctgaagacgattcttacagaaacgttagacaactacaatgaa
ctaaatgctgccatgcacctagttttgtttgaagatgccatgcaacatgtgtgtcgcatc
agccggatcttacgaacccctcagggctgtgctctcttggttggagttgggggcagtggc
aagcagagcttgtccaggctggcagcttaccttcgtggccttgaggtctttcagatcact
ctgaccgagggctatggaatccaggaacttcgggtagatcttgccaatttgtacatccga
actggagccaagaacatgcccactgtgttcctgctgacagatgcccaggttctagatgag
agcttcctcgtgctgattaatgacttgctggcatcaggagaaatcccagatctgttcagc
gatgaagatgtggacaagataatttctggaattcataatgaagttcatgctctgggcatg
gtagactccagggaaaactgttggaaattctttatggccagggtgcgactacagctcaaa
atcattttgtgtttctctccagttggtcgcacgctgagagttagagctcggaagttccca
gccatagttaactgcacggctattgactggtttcatgcgtggccgcaggaggctctggtc
tccgtcagcaggaggttcattgaggaaaccaagggaattgagccagtgcacaaagactct
attagccttttcatggcacatgttcacaccactgtaaatgaaatgagtaccagatattac
cagaatgagagaagacacaactataccaccccaaagagttttctagaacaaatatcactg
tttaagaacctgttgaagaagaagcaaaatgaggtatccgagaaaaaagaacgcctggtg
aacggcatccaaaagctaaaaaccacagcctctcaggtgggagatctaaaagccagactt
gcctctcaagaagccgagctgcaactgagaaatcatgatgccgaagctctgatcacaaag
atcggccttcagacggagaaagtgagccgggaaaagaccatcgctgatgctgaggagcga
aaggtgacagccattcagactgaagtgttccagaaacagagagaatgtgaagctgactta
ctcaaggctgagcctgcactggtggctgctacagctgcactcaatacactcaacagggtc
aacctcagtgagctgaaagcctttcccaaccctcccatcgcagttaccaatgttactgca
gccgtgatggtccttctggctcctcggggaagagtgcccaaagaccgaagttggaaagca
gctaaagtcttcatgggaaaggttgatgattttttgcaagcattaattaactatgacaaa
gagcacattccagagaactgtctaaaagtggtgaatgaacactatttgaaagacccagag
tttaatccaaacctgattcgaaccaaatcttttgcagcagctggcctgtgtgcctgggtc
atcaacatcattaaattctatgaggtctactgtgatgtggagccaaaacgccaagcatta
gcccaagcaaacttagaactggctgcagctactgaaaaactagaggctatcaggaaaaag
cttgtggatctggatcgaaatctgagcagactcacggcttcatttgaaaaagcaacagct
gagaaagtccggtgtcaagaagaggtgaaccaaaccaacaaaaccatcaaattagctaac
agacttgtcaaggaacttgaggcaaagaagattcgctggggtcaatccattaagtccttt
gaagctcaagagaagacactctgtggagatgttcttctcacggcggcatttgtgtcttac
gtcggacccttcacaaggcagtatcgccaggagctggtgcactgcaagtgggttcccttt
cttcaacagaaggtttccattccactaaccgaaggcctggacttgatatccatgttgacg
gatgatgctacaattgccgcctggaataacgaaggactgcccagtgacagaatgtccacc
gaaaatgccgctatcctaacacactgtgagcgctggcctctggtgatagatccccagcaa
cagggaattaagtggatcaagaataagtatggaatggacctgaaagtcacacatttgggc
cagaaagggtttttgaatgccattgaaactgctttggcctttggtgatgtcatcttaatt
gaaaatctcgaggaaacgatagatccagtcctggatccactacttggcaggaacacaatt
aaaaaaggaaagtatatcaggattggagataaagaatgtgaatttaacaagaactttcgc
cttatccttcacacaaaattggcaaatcctcactataagccggaattacaagctcagaca
actctcctcaatttcacagtcacagaagatggtctagaagcccagctgctggcagaggtt
gtcagtattgaaaggccagatttggagaaacttaagttggtattgacaaagcaccaaaat
gattttaaaattgagctcaagtatctggaagacgatctccttttgcgcctttctgcggca
gagggaagctttctggatgacaccaaactggtagagagattggaggcaacaaagaccacc
gtggcagagatagagcacaaggtgattgaagccaaagaaaatgaaagaaaaatcaacgag
gcccgagaatgttacagaccagtggcagcaagagcatctcttctttattttgttattaat
gacctccaaaaaatcaaccccctctaccaattctctttgaaggcttttaacgtgctgttc
cacagagcgatcgagcaggctgacaaggtggaagacatgcagggacgcatctctatcctg
atggagagcatcacccatgctgtcttcctctacaccagccaggcgctgtttgagaaggac
aagctcaccttcctgtcccagatggcttttcagattttgttgagaaagaaagagatagac
cctcttgaattggatttcctgcttcgattcacagttgaacacactcatctgagtcccgtt
gacttcctaacttctcagtcatggagtgctatcaaggcaattgccgtcatggaagaattt
cgaggcatagaccgagatgtggaaggatctgccaagcagtggaggaagtgggtagaatcc
gagtgtccagaaaaagaaaaattacctcaagaatggaagaagaaaagtttaatacagaag
ctgattcttctgagagcaatgcgccctgacagaatgacgtatgctctcagaaattttgta
gaggaaaaactgggtgcgaagtatgtggagaggaccagattggacttagttaaagcattc
gaagaaagcagcccagccacccccatattcttcatcctgtctccgggggtagatgccctt
aaagacctggagattcttggcaaaagacttggctttacaattgactctggaaaattccac
aatgtgtctttaggacaaggtcaggagacggtggcagaagtggccctggagaaagcttcc
aaaggaggacactgggtcatcctccaaaatgttcatttggtagccaagtggctaggaacc
ttggagaagctccttgaaagattcagccaaggaagccacagagattacagggttttcatg
agtgctgagtctgcacctacaccagatgagcatatcatccctcaaggactcctggaaaat
tccattaagatcactaatgaacccccaacagggatgctggccaatttgcatgccgccctg
tacaactttgatcaggatacacttgaaatatgctccaaggagcaggagtttaaaagcatc
cttttttctctctgctacttccacgcctgtgttgctgggagactgaggtttggcccccag
ggctggagccgaagctatccttttaatcctggagacctcaccatttgtgccagtgtcctc
tacaactacttagaggcaaactctaaagtcccatgggaagatctccgttatctctttggt
gagatcatgtatggaggccacatcacagatgactgggatcgcaaactgtgtcgggtgtat
ttagaagaattcatgaatccatctctgactgaagatgaactgatgctggcaccaggtttt
gctgccccaccctacctagattatgcaggctaccaccagtacatagaggagatgcttcct
ccagaaagcccggcactgtatggcctccacccaaatgctgaaatagaattcctgacagtg
acatccaacactctcttcagaactttgctggagatgcagcccaggaatgcactcagtggt
gatgaactggggcagtctacagaagaaaaggttaagaatgtcttggatgacattttggag
aaacttccagaagagttcaacatggcagagataatgcaaaaaaattcaaatagaagccca
tatgttcttgtttgcttccaagaatgtgagaggatgaatattctcattcgggaaatacgt
atatcacttgaacaactggaccttagtttgaagggggaattggcattatctcctgctgtg
gaagcccagcagtttgcattgagttatgacacggtaccagacacttggagcaaactggct
tatccttctacttatggcctagcccagtggttcaatgacctcctcctgcgatgccgagaa
ctcgatacttggacacaagaccttacccttccggctgtcgtgtggctctccggcttcttc
aaccctcagtccttcttaactgcaatcatgcagacgatggctcgaaaaaatgagtggccc
ctggataaaacgcgcttgactgctgatgttaccaaaaaaacaaaggaagattatggacac
ccgccaagggaaggtgcatacctccacggactcttcatggagggcgcccgctgggacacc
caagcaggaaccattgttgaagcccgtctcaaggagctggcatgccctatgccggtcatc
tttgcaaaagccacccccgtggacagacaagaaaccaaacagacctacgagtgccctgtg
tatagaaccaaactgagaggccccagctacatctggaccttcaggctgaagagcgaagag
aagactgcaaaatgggttctggctggagtggctctgcttctagaagcgtaa

DBGET integrated database retrieval system