KEGG   Homo sapiens (human): 8723Help
Entry
8723              CDS       T01001                                 

Gene name
SNX4, ATG24B
Definition
(RefSeq) sorting nexin 4
  KO
K17919  sorting nexin-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8723 (SNX4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8723 (SNX4)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    8723 (SNX4)
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    8723 (SNX4)
 Autophagy
  Cytoplasm to vacuolar targeting (CVT) pathway
   Other Cvt associated proteins
    8723 (SNX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX Vps5 FlgM
Motif
Other DBs
NCBI-GeneID: 8723
NCBI-ProteinID: NP_003785
OMIM: 605931
HGNC: 11175
Ensembl: ENSG00000114520
Vega: OTTHUMG00000159575
Pharos: O95219(Tbio)
UniProt: O95219
LinkDB All DBs
Position
3q21.2
AA seq 450 aa AA seqDB search
MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVY
YPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLF
LTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRV
RARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTT
KLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE
ALISYAVMQISMCKKGIQVWTNAKECFSKM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggcacctccggaccccgagcggcagctccagccggcgcccttggagccgctg
ggctccccagacgctgggctgggggctgcggtcggcaaggaagcggagggggccggagaa
gagagctctggggtcgacacgatgacacacaataatttttggttgaagaagatagaaatc
agtgtttcagaagcagaaaaacgaactggaagaaatgccatgaacatgcaagaaacatat
actgcttacctcattgaaacaaggtcagttgaacataccgatggtcagagtgtcctaaca
gactcactatggcggcgatatagtgaatttgagttgttgagaagctaccttttagtttac
tatccacatattgttgtgccacctctgccagaaaaacgggcagaatttgtttggcataaa
ctctctgctgacaacatggatccagattttgtggagaggcgacggattggtttagaaaac
tttctcttgaggattgcttcacatcccatcctttgtagagacaaaatcttctatctgttt
ttaacacaggaaggtaactggaaggagactgtgaatgaaactgggtttcagctgaaggca
gactccaggttaaaagcgcttaatgcaacattcagagtgaaaaacccagacaagagattt
actgaccttaagcactatagtgatgaactgcagtctgtcatctcacatcttcttcgagtc
agagctagagtagcagatcgactctatggtgtatataaagtacatgggaattatggtcga
gttttcagtgaatggagtgccatagaaaaagaaatgggtgatggactgcagagtgctggt
catcatatggatgtgtatgcatcttctattgatgatattttggaagatgaagaacattat
gcagatcagttaaaagagtatcttttttatgcagaagcattgcgggctgtgtgcaggaaa
catgaacttatgcagtatgacttggagatggctgctcaggacttagcatccaagaagcag
cagtgtgaggaactggtaactgggactgtgagaacattctctttgaagggaatgactacc
aagctctttggtcaagaaactccagagcagagagaagccagaataaaggtgctagaagaa
caaataaatgaaggagaacaacagctaaagtctaaaaatctggaaggcagagaatttgtg
aaaaacgcatgggctgatattgaacgcttcaaagaacaaaagaaccgagacttaaaggag
gccctcataagctatgcagtcatgcagatcagtatgtgcaaaaagggaattcaagtttgg
accaatgctaaggaatgctttagcaagatgtaa

DBGET integrated database retrieval system