KEGG   Homo sapiens (human): 8739
Entry
8739              CDS       T01001                                 

Gene name
HRK, DP5, HARAKIRI
Definition
(RefSeq) harakiri, BCL2 interacting protein
  KO
K02512  activator of apoptosis harakiri
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8739 (HRK)
SSDB
Motif
Pfam: Harakiri DUF1018
Other DBs
NCBI-GeneID: 8739
NCBI-ProteinID: NP_003797
OMIM: 603447
HGNC: 5185
Ensembl: ENSG00000135116
Vega: OTTHUMG00000169328
Pharos: O00198(Tbio)
UniProt: O00198
LinkDB
Position
12q24.22
AA seq 91 aa
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAP
APGALPTYWPWLCAAAQVAALAAWLLGRRNL
NT seq 276 nt   +upstreamnt  +downstreamnt
atgtgcccgtgccccctgcaccgcggccgcggccccccggccgtgtgcgcctgcagcgcg
ggtcgcctggggctgcgctcgtccgccgcgcagctcaccgccgcccggctcaaggcgcta
ggcgacgagctgcaccagcgcaccatgtggcggcgccgcgcgcggagccggagggcgccg
gcgcccggcgcgctccccacctactggccttggctgtgcgcggccgcgcaggtggcggcg
ctggcggcctggctgctcggcaggcggaacttgtag

DBGET integrated database retrieval system