KEGG   Homo sapiens (human): 8764Help
Entry
8764              CDS       T01001                                 

Gene name
TNFRSF14, ATAR, CD270, HVEA, HVEM, LIGHTR, TR2
Definition
(RefSeq) TNF receptor superfamily member 14
  KO
K05152  tumor necrosis factor receptor superfamily member 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa05168  Herpes simplex virus 1 infection
Network
nt06123  TNF signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8764 (TNFRSF14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8764 (TNFRSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8764 (TNFRSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8764 (TNFRSF14)
   04090 CD molecules [BR:hsa04090]
    8764 (TNFRSF14)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8764 (TNFRSF14)
CD molecules [BR:hsa04090]
 Proteins
  8764 (TNFRSF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Hum_adeno_E3A MHYT Peptidase_U4
Motif
Other DBs
NCBI-GeneID: 8764
NCBI-ProteinID: NP_003811
OMIM: 602746
HGNC: 11912
Ensembl: ENSG00000157873
Vega: OTTHUMG00000000792
Pharos: Q92956(Tbio)
UniProt: Q92956 A0A024R052
LinkDB All DBs
Structure
PDB: 

Position
1p36.32
AA seq 283 aa AA seqDB search
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggagcctcctggagactgggggcctcctccctggagatccacccccaaaaccgacgtc
ttgaggctggtgctgtatctcaccttcctgggagccccctgctacgccccagctctgccg
tcctgcaaggaggacgagtacccagtgggctccgagtgctgccccaagtgcagtccaggt
tatcgtgtgaaggaggcctgcggggagctgacgggcacagtgtgtgaaccctgccctcca
ggcacctacattgcccacctcaatggcctaagcaagtgtctgcagtgccaaatgtgtgac
ccagccatgggcctgcgcgcgagccggaactgctccaggacagagaacgccgtgtgtggc
tgcagcccaggccacttctgcatcgtccaggacggggaccactgcgccgcgtgccgcgct
tacgccacctccagcccgggccagagggtgcagaagggaggcaccgagagtcaggacacc
ctgtgtcagaactgccccccggggaccttctctcccaatgggaccctggaggaatgtcag
caccagaccaagtgcagctggctggtgacgaaggccggagctgggaccagcagctcccac
tgggtatggtggtttctctcagggagcctcgtcatcgtcattgtttgctccacagttggc
ctaatcatatgtgtgaaaagaagaaagccaaggggtgatgtagtcaaggtgatcgtctcc
gtccagcggaaaagacaggaggcagaaggtgaggccacagtcattgaggccctgcaggcc
cctccggacgtcaccacggtggccgtggaggagacaataccctcattcacggggaggagc
ccaaaccactga

DBGET integrated database retrieval system