KEGG   Homo sapiens (human): 8766
Entry
8766              CDS       T01001                                 

Gene name
RAB11A, YL8
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04962  Vasopressin-regulated water reabsorption
hsa04972  Pancreatic secretion
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8766 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    8766 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    8766 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    8766 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    8766 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8766 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8766 (RAB11A)
   04031 GTP-binding proteins [BR:hsa04031]
    8766 (RAB11A)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    8766 (RAB11A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8766 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   8766 (RAB11A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    8766 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 8766
NCBI-ProteinID: NP_004654
OMIM: 605570
HGNC: 9760
Ensembl: ENSG00000103769
Vega: OTTHUMG00000133162
Pharos: P62491(Tbio)
UniProt: P62491 A0A024R5Z8
LinkDB
Structure
PDB: 

Position
15q22.31
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctctttaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgagtttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgatggaaaaacaata
aaggcacagatatgggacacagcagggcaagagcgatatcgagctataacatcagcatat
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacatatgaa
aatgtagagcgatggctgaaagaactgagagatcatgctgatagtaacattgttatcatg
cttgtgggcaataagagtgatctacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaatggtttgtcattcattgaaacttcggccctagactctacaaat
gtagaagctgcttttcagacaattttaacagagatttaccgcattgtttctcagaagcaa
atgtcagacagacgcgaaaatgacatgtctccaagcaacaatgtggttcctattcatgtt
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

DBGET integrated database retrieval system