KEGG   Homo sapiens (human): 8773Help
Entry
8773              CDS       T01001                                 

Gene name
SNAP23, HsT17016, SNAP-23, SNAP23A, SNAP23B
Definition
(RefSeq) synaptosome associated protein 23
  KO
K08508  synaptosomal-associated protein 23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    8773 (SNAP23)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8773 (SNAP23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8773 (SNAP23)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8773 (SNAP23)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-23
    8773 (SNAP23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8773 (SNAP23)
  Exosomal proteins of other body fluids (saliva and urine)
   8773 (SNAP23)
  Exosomal proteins of colorectal cancer cells
   8773 (SNAP23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNAP-25 DUF5089 V-SNARE_C DUF1664 Sec20
Motif
Other DBs
NCBI-GeneID: 8773
NCBI-ProteinID: NP_003816
OMIM: 602534
HGNC: 11131
Ensembl: ENSG00000092531
Vega: OTTHUMG00000130625
Pharos: O00161(Tbio)
UniProt: O00161 A8K287
LinkDB All DBs
Structure
PDB: 

Position
15q15.1-q15.2
AA seq 211 aa AA seqDB search
MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLD
QINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPG
PVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQ
NPQIKRITDKADTNRDRIDIANARAKKLIDS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggataatctgtcatcagaagaaattcaacagagagctcaccagattactgatgagtct
ctggaaagtacgaggagaatcctgggtttagccattgagtctcaggatgcaggaatcaag
accatcactatgctggatgaacaaaaggaacaactaaaccgcatagaagaaggcttggac
caaataaataaggacatgagagagacagagaagactttaacagaactcaacaaatgctgt
ggcctttgtgtctgcccatgtaatagaacaaagaactttgagtctggcaaggcttataag
acaacatggggagatggtggagaaaactcaccttgcaatgtagtatctaaacagccaggc
ccggtgacaaatggtcagcttcagcaaccaacaacgggagcagccagtggtggatacatt
aaacgcataactaatgatgccagagaagatgaaatggaagagaacctgactcaagtgggc
agtatcctgggaaatctaaaagacatggccctgaacataggcaatgagattgatgctcaa
aatccacaaataaaacgaatcacagacaaggctgacaccaacagagatcgtattgatatt
gccaatgccagagcaaagaaactcattgacagctaa

DBGET integrated database retrieval system