KEGG   Homo sapiens (human): 8777
Entry
8777              CDS       T01001                                 

Gene name
MPDZ, HYC2, MUPP1
Definition
(RefSeq) multiple PDZ domain crumbs cell polarity complex component
  KO
K06095  multiple PDZ domain protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
Disease
H01677  Congenital hydrocephalus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    8777 (MPDZ)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 L27_2 MPDZ_u10 L27_1
Other DBs
NCBI-GeneID: 8777
NCBI-ProteinID: NP_001317566
OMIM: 603785
HGNC: 7208
Ensembl: ENSG00000107186
Vega: OTTHUMG00000021031
Pharos: O75970(Tbio)
UniProt: O75970
LinkDB
Structure
PDB: 

Position
9p23
AA seq 2070 aa
MLEAIDKNRALHAAERLQTKLRERGDVANEDKLSLLKSVLQSPLFSQILSLQTSVQQLKD
QVNIATSATSNIEYAHVPHLSPAVIPTLQNESFLLSPNNGNLEALTGPGIPHINGKPACD
EFDQLIKNMAQGRHVEVFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDG
RLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAA
STISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGD
HILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPE
LRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDG
RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDA
DLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTK
WQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELL
EVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVD
LGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDP
IDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVR
IGVAKPLPLSPEEGYVSAKEDSFLYPPHSCEEAGLADKPLFRADLALVGTNDADLVDEST
FESPYSPENDSIYSTQASILSLHGSSCGDGLNYGSSLPSSPPKDVIENSCDPVLDLHMSL
EELYTQNLLQRQDENTPSVDISMGPASGFTINDYTPANAIEQQYECENTIVWTESHLPSE
VISSAELPSVLPDSAGKGSEYLLEQSSLACNAECVMLQNVSKESFERTINIAKGNSSLGM
TVSANKDGLGMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLI
GPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQN
TAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNG
TLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYP
KYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKI
SQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGI
DPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMA
VCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEE
DTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI
HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATC
PIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEV
NGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
VGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVT
LEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGL
RTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTS
TEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDL
GPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAV
NGQSLEGVTHEEAVAILKRTKGTVTLMVLS
NT seq 6213 nt   +upstreamnt  +downstreamnt
atgttggaagccattgacaaaaatcgggccctgcatgcagcagagcgcttgcaaaccaag
ctgcgagaacgtggggatgtagcaaatgaagacaaactgagccttctgaagtcagtcctg
cagagccctctcttcagtcagattctgagccttcagacttctgtacagcagctgaaagac
caggtaaatattgcaacttcagcaacttcaaatattgaatatgcccacgttcctcatctc
agcccagctgtgattcctactctgcaaaatgaatcgtttttattatccccaaacaatggg
aatctggaagcacttacaggacctggtattccacacattaatgggaaacctgcttgtgat
gaatttgatcagcttatcaaaaatatggcccagggtcgccatgtagaagtttttgagctc
ctcaaacctccatctggaggccttgggtttagtgttgtgggactaagaagtgaaaacaga
ggagagctgggaatatttgttcaagagatacaagagggcagtgtggcccatagagatgga
agattgaaagaaactgatcaaattcttgctatcaatggacaggctcttgatcagacaatt
acacatcagcaggctatcagcatcctgcagaaagccaaagatactgtccagctagttatt
gccagaggctcattgcctcagcttgtcagccccatagtttcccgttctccatctgcagcc
agcacaatttcagctcactctaatccggttcactggcaacacatggaaacgattgaattg
gtgaatgatggatctggtttgggatttggcatcataggaggaaaagcaactggtgtgata
gtaaaaaccattctgcctggaggagtagctgatcagcatgggcgtttatgcagtggagac
cacattctaaagattggtgacacagatctagcaggaatgagcagtgagcaagtagcacaa
gtccttaggcaatgtggaaatagagttaagttgatgattgcaagaggtgccatagaagaa
cgtacagcacccactgctttgggcatcaccctctcctcatccccaacttcaacaccagag
ttgcgggttgatgcttctactcagaaaggtgaagaaagtgagacatttgatgtagaactc
actaaaaatgtccaaggattaggaattaccattgctggctacattggagataaaaaattg
gaaccttcaggaatctttgtaaagagcattacaaaaagcagtgccgttgagcatgatgga
agaatccaaattggagaccaaattatagcagtagatggcacaaaccttcagggttttact
aatcagcaagcagtagaggtattgcgacatacaggacaaactgtgctcctgacactaatg
aggagaggaatgaagcaggaagccgagctcatgtcaagggaagacgtcacaaaagatgca
gatttgtctcctgttaatgccagcataatcaaagaaaattatgaaaaagatgaagatttt
ttatcttcgacgagaaacaccaacatattaccaactgaagaagaagggtatccattactg
tcagctgagatagaagaaatagaagatgcacaaaaacaagaagctgctctgctgacaaaa
tggcaaaggattatgggaattaactatgaaatagtggtggcccatgtgagcaagtttagt
gagaacagtggattggggataagcctggaagcgacagtgggacatcattttatccgatct
gttctaccagagggtcctgttggacacagcgggaagctcttcagtggagacgagctattg
gaagtaaatggcataactttacttggggaaaatcaccaagatgtggtgaatatcttaaaa
gaactgcctatagaagtgacaatggtgtgctgtcgtcgaactgtgccacccaccacccaa
tcagaattggatagcctggacttatgtgatattgagctaacagaaaagcctcacgtagat
ctaggtgagttcatcgggtcatcagagacagaggatccagtgctggcgatgactgatgcg
ggtcagagtacagaagaggttcaagcacctttggccatgtgggaggctggcattcagcac
atagagctggagaaagggagcaaaggacttggttttagcattttagattatcaggatcca
attgatccagcaagcactgtgattataattcgttctttggtgcctggcggcattgctgaa
aaggatggacgacttcttcctggtgaccgactcatgtttgtaaacgatgttaacttggaa
aacagcagtcttgaggaagctgtagaagcactgaagggagcaccgtcagggactgtgaga
ataggagttgctaagcctttacccctttcaccagaagaaggttatgtttctgctaaggag
gattcctttctctacccaccacactcctgtgaggaagcagggctggctgacaaacccctc
ttcagggctgacttggctctggtgggcacaaatgatgctgacttagtagatgaatccaca
tttgagtctccatactctcctgaaaatgacagcatctactctactcaagcctctatttta
tctcttcatggcagttcttgtggtgatggcctgaactatggttcttcccttccatcatct
cctcctaaggatgttattgaaaattcttgtgatccagtacttgatctgcatatgtctctg
gaggaactatatacccagaatctcctgcaaagacaggatgagaatacaccttcggtggac
ataagtatggggcctgcttctggctttactataaatgactacacacctgcaaatgctatt
gaacaacaatatgaatgtgaaaacacaatagtgtggactgaatctcatttaccaagtgaa
gttatatcaagtgcagaacttccttctgtgctacccgattcagctggaaagggctctgag
tacctgcttgaacagagctccctggcctgtaatgctgagtgtgtcatgcttcaaaatgta
tctaaagaatcttttgaaaggactattaatatagcaaaaggcaattctagcctaggaatg
acagttagtgctaataaagatggcttggggatgatcgttcgaagcattattcatggaggt
gccattagtcgagatggccggattgccattggggactgcatcttgtccattaatgaagag
tctaccatcagtgtaaccaatgcccaggcacgagctatgttgagaagacattctctcatt
ggccctgacataaaaattacttatgtgcctgcagaacatttggaagagttcaaaataagc
ttgggacaacaatctggaagagtaatggcactggatattttttcttcatacactggcaga
gacattccagaattaccagagcgagaagagggagagggtgaagaaagcgaacttcaaaac
acagcatatagcaattggaatcagcccaggcgggtggaactctggagagaaccaagcaaa
tccttaggcatcagcattgttggtggacgagggatggggagtcggctaagcaatggagaa
gtgatgaggggcattttcatcaaacatgttctggaagatagtccagctggcaaaaatgga
accttgaaacctggagatagaatcgtagaggtggatggaatggacctcagagatgcaagc
catgaacaagctgtggaagccattcggaaagcaggcaaccctgtagtctttatggtacag
agcattataaacagaccaaggaaatcccctttgccttccttgctgcacaacctttaccct
aagtacaacttcagcagcactaacccatttgctgactctctacaaatcaacgccgacaag
gcacccagtcagtcagagtcagagccagagaaggctccattgtgcagtgtgcccccaccc
cctccttcagcctttgccgaaatgggtagtgatcacacacagtcatctgcaagcaaaatc
tcacaagatgtggacaaagaggatgagtttggttacagctggaaaaatatcagagagcgt
tatggaaccctaacaggcgagctgcatatgattgaactggagaaaggtcatagtggtttg
ggcctaagtcttgctgggaacaaagaccgatccaggatgagtgtcttcatagtggggatt
gatccaaatggagctgcaggaaaagatggtcgattgcaaattgcagatgagcttctagag
atcaatggtcagattttatatggaagaagtcatcagaatgcctcatcaatcattaaatgt
gccccttctaaagtgaaaataatttttatcagaaataaagatgcagtgaatcagatggcc
gtatgtcctggaaatgcagtagaacctttgccttctaactcagaaaatcttcaaaataag
gagacagagccaactgttactacttctgatgcagctgtggacctcagttcatttaaaaat
gtgcaacatctggagcttcccaaggatcaggggggtttgggtattgctatcagcgaagaa
gatacactcagtggagtcatcataaagagcttaacagagcatggggtagcagccacggat
ggacgactcaaagtcggagatcagatactggctgtagatgatgaaattgttgttggttac
cctattgaaaagtttattagccttctgaagacagcaaagatgacagtaaaacttaccatc
catgctgagaatccagattcccaggctgttccttcagcagctggtgcagccagtggagaa
aaaaagaacagctcccagtctctgatggtcccacagtctggctccccagaaccggagtcc
atccgaaatacaagcagatcatcaacaccagcaatttttgcttctgatcctgcaacctgc
cccattatccctggctgcgaaacaaccatcgagatttccaaagggcgaacagggctgggc
ctgagcatcgttgggggttcagacacgctgctgggtgccattattatccatgaagtttat
gaagaaggagcagcatgtaaagatggaagactctgggctggagatcagatcttagaggtg
aatggaattgacttgagaaaggccacacatgatgaagcaatcaatgtcctgagacagacg
ccacagagagtgcgcctgacactctacagagatgaggccccatacaaagaggaggaagtg
tgtgacaccctcactattgagctgcagaagaagccgggaaaaggcctaggattaagtatt
gttggtaaaagaaacgatactggagtatttgtgtcagacattgtcaaaggaggaattgca
gatgccgatggaagactgatgcagggagaccagatattaatggtgaatggggaagacgtt
cgtaatgccacccaagaagcggttgccgctttgctaaagtgttccctaggcacagtaacc
ttggaagttggaagaatcaaagctggtccattccattcagagaggaggccatctcaaagc
agccaggtgagtgaaggcagcctgtcatctttcacttttccactctctggatccagtaca
tctgagtcactggaaagtagctcaaagaagaatgcattggcatctgaaatacagggatta
agaacagtcgaaatgaaaaagggccctactgactcactgggaatcagcatcgctggagga
gtaggcagcccacttggtgatgtgcctatatttattgcaatgatgcacccaactggagtt
gcagcacagacccaaaaactcagagttggggataggattgtcaccatctgtggcacatcc
actgagggcatgactcacacccaagcagttaacctactgaaaaatgcatctggctccatt
gaaatgcaggtggttgctggaggagacgtgagtgtggtcacaggtcatcagcaggagcct
gcaagttccagtctttctttcactgggctgacgtcaagcagtatatttcaggatgattta
ggacctcctcaatgtaagtctattacactagagcgaggaccagatggcttaggcttcagt
atagttggaggatatggcagccctcatggagacttacccatttatgttaaaacagtgttt
gcaaagggagcagcctctgaagacggacgtctgaaaaggggcgatcagatcattgctgtc
aatgggcagagtctagaaggagtcacccatgaagaagctgttgccatccttaaacggaca
aaaggcactgtcactttgatggttctctcttga

DBGET integrated database retrieval system