KEGG   Homo sapiens (human): 8793Help
Entry
8793              CDS       T01001                                 

Gene name
TNFRSF10D, CD264, DCR2, TRAIL-R4, TRAILR4, TRUNDD
Definition
(RefSeq) TNF receptor superfamily member 10d
  KO
K22702  tumor necrosis factor receptor superfamily member 10D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8793 (TNFRSF10D)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8793 (TNFRSF10D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8793 (TNFRSF10D)
   04090 CD molecules [BR:hsa04090]
    8793 (TNFRSF10D)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8793 (TNFRSF10D)
CD molecules [BR:hsa04090]
 Proteins
  8793 (TNFRSF10D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 ECSCR ODV-E18 ASFV_J13L
Motif
Other DBs
NCBI-GeneID: 8793
NCBI-ProteinID: NP_003831
OMIM: 603614
HGNC: 11907
Ensembl: ENSG00000173530
Vega: OTTHUMG00000097845
Pharos: Q9UBN6(Tbio)
UniProt: Q9UBN6
LinkDB All DBs
Position
8p21.3
AA seq 386 aa AA seqDB search
MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPR
QDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTV
CKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKC
KNESAASSTGKTPAAEETVTTILGMLASPYHYLIIIVVLVIILAVVVVGFSCRKKFISYL
KGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQEL
AELTGVTVELPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKE
TIQDQLVGSEKLFYEEDEAGSATSCL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggactttggggacaaagcgtcccgaccgcctcgagcgctcgagcagggcgctatcca
ggagccaggacagcgtcgggaaccagaccatggctcctggaccccaagatccttaagttc
gtcgtcttcatcgtcgcggttctgctgccggtccgggttgactctgccaccatcccccgg
caggacgaagttccccagcagacagtggccccacagcaacagaggcgcagcctcaaggag
gaggagtgtccagcaggatctcatagatcagaatatactggagcctgtaacccgtgcaca
gagggtgtggattacaccattgcttccaacaatttgccttcttgcctgctatgtacagtt
tgtaaatcaggtcaaacaaataaaagttcctgtaccacgaccagagacaccgtgtgtcag
tgtgaaaaaggaagcttccaggataaaaactcccctgagatgtgccggacgtgtagaaca
gggtgtcccagagggatggtcaaggtcagtaattgtacgccccggagtgacatcaagtgc
aaaaatgaatcagctgccagttccactgggaaaaccccagcagcggaggagacagtgacc
accatcctggggatgcttgcctctccctatcactaccttatcatcatagtggttttagtc
atcattttagctgtggttgtggttggcttttcatgtcggaagaaattcatttcttacctc
aaaggcatctgctcaggtggtggaggaggtcccgaacgtgtgcacagagtccttttccgg
cggcgttcatgtccttcacgagttcctggggcggaggacaatgcccgcaacgagaccctg
agtaacagatacttgcagcccacccaggtctctgagcaggaaatccaaggtcaggagctg
gcagagctaacaggtgtgactgtagagttgccagaggagccacagcgtctgctggaacag
gcagaagctgaagggtgtcagaggaggaggctgctggttccagtgaatgacgctgactcc
gctgacatcagcaccttgctggatgcctcggcaacactggaagaaggacatgcaaaggaa
acaattcaggaccaactggtgggctccgaaaagctcttttatgaagaagatgaggcaggc
tctgctacgtcctgcctgtga

KEGG   Homo sapiens (human): 8794Help
Entry
8794              CDS       T01001                                 

Gene name
TNFRSF10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
Definition
(RefSeq) TNF receptor superfamily member 10c
  KO
K22701  tumor necrosis factor receptor superfamily member 10C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8794 (TNFRSF10C)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8794 (TNFRSF10C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8794 (TNFRSF10C)
   04090 CD molecules [BR:hsa04090]
    8794 (TNFRSF10C)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   8794 (TNFRSF10C)
CD molecules [BR:hsa04090]
 Proteins
  8794 (TNFRSF10C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Podoplanin
Motif
Other DBs
NCBI-GeneID: 8794
NCBI-ProteinID: NP_003832
OMIM: 603613
HGNC: 11906
Ensembl: ENSG00000173535
Vega: OTTHUMG00000097844
Pharos: O14798(Tbio)
UniProt: O14798
LinkDB All DBs
Position
8p21.3
AA seq 259 aa AA seqDB search
MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS
EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNEN
SPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAE
ETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHY
LSCTIVGIIVLIVLLIVFV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcccggatccccaagaccctaaagttcgtcgtcgtcatcgtcgcggtcctgctgcca
gtcctagcttactctgccaccactgcccggcaggaggaagttccccagcagacagtggcc
ccacagcaacagaggcacagcttcaagggggaggagtgtccagcaggatctcatagatca
gaacatactggagcctgtaacccgtgcacagagggtgtggattacaccaacgcttccaac
aatgaaccttcttgcttcccatgtacagtttgtaaatcagatcaaaaacataaaagttcc
tgcaccatgaccagagacacagtgtgtcagtgtaaagaaggcaccttccggaatgaaaac
tccccagagatgtgccggaagtgtagcaggtgccctagtggggaagtccaagtcagtaat
tgtacgtcctgggatgatatccagtgtgttgaagaatttggtgccaatgccactgtggaa
accccagctgctgaagagacaatgaacaccagcccggggactcctgccccagctgctgaa
gagacaatgaacaccagcccagggactcctgccccagctgctgaagagacaatgaccacc
agcccggggactcctgccccagctgctgaagagacaatgaccaccagcccggggactcct
gccccagctgctgaagagacaatgaccaccagcccggggactcctgcctcttctcattac
ctctcatgcaccatcgtagggatcatagttctaattgtgcttctgattgtgtttgtttga

DBGET integrated database retrieval system