KEGG   Homo sapiens (human): 8809
Entry
8809              CDS       T01001                                 

Gene name
IL18R1, CD218a, CDw218a, IL-18R-alpha, IL-18Ralpha, IL-1Rrp, IL18RA, IL18Ralpha2, IL1RRP
Definition
(RefSeq) interleukin 18 receptor 1
  KO
K05173  interleukin 18 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04668  TNF signaling pathway
hsa05321  Inflammatory bowel disease
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01269  IL18/37 to IL18R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    8809 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8809 (IL18R1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8809 (IL18R1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    8809 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8809 (IL18R1)
   04090 CD molecules [BR:hsa04090]
    8809 (IL18R1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8809 (IL18R1)
CD molecules [BR:hsa04090]
 Proteins
  8809 (IL18R1)
SSDB
Motif
Pfam: TIR V-set TIR_2 Ig_2 Ig_3 I-set Ig_6 Ig_5
Other DBs
NCBI-GeneID: 8809
NCBI-ProteinID: NP_003846
OMIM: 604494
HGNC: 5988
Ensembl: ENSG00000115604
Vega: OTTHUMG00000130780
Pharos: Q13478(Tbio)
UniProt: Q13478
LinkDB
Structure
PDB: 
4R6U 3WO3 3WO4

Position
2q12.1
AA seq 541 aa
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgaattgtagagaattacccttgaccctttgggtgcttatatctgtaagcactgcagaa
tcttgtacttcacgtccccacattactgtggttgaaggggaacctttctatctgaaacat
tgctcgtgttcacttgcacatgagattgaaacaaccaccaaaagctggtacaaaagcagt
ggatcacaggaacatgtggagctgaacccaaggagttcctcgagaattgctttgcatgat
tgtgttttggagttttggccagttgagttgaatgacacaggatcttactttttccaaatg
aaaaattatactcagaaatggaaattaaatgtcatcagaagaaataaacacagctgtttc
actgaaagacaagtaactagtaaaattgtggaagttaaaaaattttttcagataacctgt
gaaaacagttactatcaaacactggtcaacagcacatcattgtataagaactgtaaaaag
ctactactggagaacaataaaaacccaacgataaagaagaacgccgagtttgaagatcag
gggtattactcctgcgtgcatttccttcatcataatggaaaactatttaatatcaccaaa
accttcaatataacaatagtggaagatcgcagtaatatagttccggttcttcttggacca
aagcttaaccatgttgcagtggaattaggaaaaaacgtaaggctcaactgctctgctttg
ctgaatgaagaggatgtaatttattggatgttcggggaagaaaatggatcggatcctaat
atacatgaagagaaagaaatgagaattatgactccagaaggcaaatggcatgcttcaaaa
gtattgagaattgaaaatattggtgaaagcaatctaaatgttttatataattgcactgtg
gccagcacgggaggcacagacaccaaaagcttcatcttggtgagaaaagcagacatggct
gatatcccaggccacgtcttcacaagaggaatgatcatagctgttttgatcttggtggca
gtagtgtgcctagtgactgtgtgtgtcatttatagagttgacttggttctattttataga
catttaacgagaagagatgaaacattaacagatggaaaaacatatgatgcttttgtgtct
tacctaaaagaatgccgacctgaaaatggagaggagcacacctttgctgtggagattttg
cccagggtgttggagaaacattttgggtataagttatgcatatttgaaagggatgtagtg
cctggaggagctgttgttgatgaaatccactcactgatagagaaaagccgaagactaatc
attgtcctaagtaaaagttatatgtctaatgaggtcaggtatgaacttgaaagtggactc
catgaagcattggtggaaagaaaaattaaaataatcttaattgaatttacacctgttact
gacttcacattcttgccccaatcactaaagcttttgaaatctcacagagttctgaagtgg
aaggccgataaatctctttcttataactcaaggttctggaagaaccttctttacttaatg
cctgcaaaaacagtcaagccaggtagagacgaaccggaagtcttgcctgttctttccgag
tcttaa

DBGET integrated database retrieval system