KEGG   Homo sapiens (human): 8813Help
Entry
8813              CDS       T01001                                 

Gene name
DPM1, CDGIE, MPDS
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 1, catalytic
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Network
nt06015  N-Glycan biosynthesis
  Element
N00667  N-Glycan precursor biosynthesis, Glc-6P to Man-P-Dol
N00668  DPM1 deficiency in N-glycan precursor biosynthesis
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8813 (DPM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    8813 (DPM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     8813 (DPM1)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   8813 (DPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 Glyco_tranf_2_4 MapZ_C2
Motif
Other DBs
NCBI-GeneID: 8813
NCBI-ProteinID: NP_003850
OMIM: 603503
HGNC: 3005
Ensembl: ENSG00000000419
Vega: OTTHUMG00000032742
Pharos: O60762(Tbio)
UniProt: O60762 A0A0S2Z4Y5
LinkDB All DBs
Position
20q13.13
AA seq 260 aa AA seqDB search
MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEI
IIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDAD
LSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGA
SDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESK
LGGNEIVSFLKGLLTLFATT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttggaagtcagtcgtagtcctcgcaggtctcggcgggagctggaagtgcgc
agtccacgacagaacaaatattcggtgcttttacctacctacaacgagcgcgagaacctg
ccgctcatcgtgtggctgctggtgaaaagcttctccgagagtggaatcaactatgaaatt
ataatcatagatgatggaagcccagatggaacaagggatgttgctgaacagttggagaag
atctatgggtcagacagaattcttctaagaccacgagagaaaaagttgggactaggaact
gcatatattcatggaatgaaacatgccacaggaaactacatcattattatggatgctgat
ctctcacaccatccaaaatttattcctgaatttattaggaagcaaaaggagggtaatttt
gatattgtctctggaactcgctacaaaggaaatggaggtgtatatggctgggatttgaaa
agaaaaataatcagccgtggggccaattttttaactcagatcttgctgagaccaggagca
tctgatttaacaggaagtttcagattataccgaaaagaagttctagagaaattaatagaa
aaatgtgtttctaaaggctacgtcttccagatggagatgattgttcgggcaagacagttg
aattatactattggcgaggttccaatatcatttgtggatcgtgtttatggtgaatccaag
ttgggaggaaatgaaatagtatctttcttgaaaggattattgactctttttgctactaca
taa

KEGG   Homo sapiens (human): 8818Help
Entry
8818              CDS       T01001                                 

Gene name
DPM2, CDG1U
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 2, regulatory
  KO
K09658  dolichol phosphate-mannose biosynthesis regulatory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06015  N-Glycan biosynthesis
nt06018  GPI-anchor biosynthesis
  Element
N00667  N-Glycan precursor biosynthesis, Glc-6P to Man-P-Dol
N00669  DPM2 deficiency in N-glycan precursor biosynthesis
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
N00752  PIGN deficiency in GPI-anchor biosynthesis
N00753  PIGV deficiency in GPI-anchor biosynthesis
N00754  PIGM deficiency in GPI-anchor biosynthesis
N00755  PIGW deficiency in GPI-anchor biosynthesis
N00756  PIGL deficiency in GPI-anchor biosynthesis
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8818 (DPM2)
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    8818 (DPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPM2 PIG-P
Motif
Other DBs
NCBI-GeneID: 8818
NCBI-ProteinID: NP_003854
OMIM: 603564
HGNC: 3006
Ensembl: ENSG00000136908
Vega: OTTHUMG00000020725
Pharos: O94777(Tdark)
UniProt: O94777
LinkDB All DBs
Position
9q34.11
AA seq 84 aa AA seqDB search
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLL
LLLFVGLFISYVMLKTKRVTKKAQ
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggccacggggacagaccaggtggtgggactcggcctcgtcgccgttagcctgatcatc
ttcacctactacaccgcctgggtgattctcttgccattcatcgacagtcagcatgtcatc
cacaagtatttcctgccccgagcctatgctgtcgccatcccactggctgcaggcctcctg
ctgctcctgtttgtgggactgttcatctcctatgtgatgctgaagaccaagagagtgacc
aagaaggctcagtga

KEGG   Homo sapiens (human): 54344Help
Entry
54344             CDS       T01001                                 

Gene name
DPM3, CDG1O
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 3, regulatory
  KO
K09659  dolichol-phosphate mannosyltransferase subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Network
nt06015  N-Glycan biosynthesis
  Element
N00667  N-Glycan precursor biosynthesis, Glc-6P to Man-P-Dol
N00670  DPM3 deficiency in N-glycan precursor biosynthesis
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    54344 (DPM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPM3
Motif
Other DBs
NCBI-GeneID: 54344
NCBI-ProteinID: NP_714963
OMIM: 605951
HGNC: 3007
Ensembl: ENSG00000179085
Vega: OTTHUMG00000035335
Pharos: Q9P2X0(Tdark)
UniProt: Q9P2X0 Q86TM7
LinkDB All DBs
Position
1q22
AA seq 92 aa AA seqDB search
MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYR
VATFHDCEDAARELQSQIQEARADLARRGLRF
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaattagcgcagtggctttggggactagcgatcctgggctccacctgggtggcc
ctgaccacgggagccttgggcctggagctgcccttgtcctgccaggaagtcctgtggcca
ctgcccgcctacttgctggtgtccgccggctgctatgccctgggcactgtgggctatcgt
gtggccacttttcatgactgcgaggacgccgcacgcgagctgcagagccagatacaggag
gcccgagccgacttagcccgcagggggctgcgcttctga

DBGET integrated database retrieval system