KEGG   Homo sapiens (human): 8818Help
Entry
8818              CDS       T01001                                 

Gene name
DPM2, CDG1U
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 2, regulatory
  KO
K09658  dolichol phosphate-mannose biosynthesis regulatory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00065  GPI-anchor biosynthesis, core oligosaccharide
Network
nt06015  N-Glycan biosynthesis
nt06018  GPI-anchor biosynthesis
  Element
N00667  N-Glycan precursor biosynthesis, Glc-6P to Man-P-Dol
N00669  DPM2 deficiency in N-glycan precursor biosynthesis
N00748  GPI-anchor biosynthesis
N00749  PGAP1 deficiency in GPI-anchor biosynthesis
N00750  PIGT deficiency in GPI-anchor biosynthesis
N00751  PIGO deficiency in GPI-anchor biosynthesis
N00752  PIGN deficiency in GPI-anchor biosynthesis
N00753  PIGV deficiency in GPI-anchor biosynthesis
N00754  PIGM deficiency in GPI-anchor biosynthesis
N00755  PIGW deficiency in GPI-anchor biosynthesis
N00756  PIGL deficiency in GPI-anchor biosynthesis
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8818 (DPM2)
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    8818 (DPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPM2 PIG-P
Motif
Other DBs
NCBI-GeneID: 8818
NCBI-ProteinID: NP_003854
OMIM: 603564
HGNC: 3006
Ensembl: ENSG00000136908
Vega: OTTHUMG00000020725
Pharos: O94777(Tdark)
UniProt: O94777
LinkDB All DBs
Position
9q34.11
AA seq 84 aa AA seqDB search
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLL
LLLFVGLFISYVMLKTKRVTKKAQ
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggccacggggacagaccaggtggtgggactcggcctcgtcgccgttagcctgatcatc
ttcacctactacaccgcctgggtgattctcttgccattcatcgacagtcagcatgtcatc
cacaagtatttcctgccccgagcctatgctgtcgccatcccactggctgcaggcctcctg
ctgctcctgtttgtgggactgttcatctcctatgtgatgctgaagaccaagagagtgacc
aagaaggctcagtga

DBGET integrated database retrieval system