KEGG   Homo sapiens (human): 8819Help
Entry
8819              CDS       T01001                                 

Gene name
SAP30
Definition
(RefSeq) Sin3A associated protein 30
  KO
K19202  histone deacetylase complex subunit SAP30
Organism
hsa  Homo sapiens (human)
Pathway
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    8819 (SAP30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8819 (SAP30)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     8819 (SAP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-SAP30 SAP30_Sin3_bdg
Motif
Other DBs
NCBI-GeneID: 8819
NCBI-ProteinID: NP_003855
OMIM: 603378
HGNC: 10532
Ensembl: ENSG00000164105
Vega: OTTHUMG00000160798
Pharos: O75446(Tbio)
UniProt: O75446
LinkDB All DBs
Structure
PDB: 

Position
4q34.1
AA seq 220 aa AA seqDB search
MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAG
PGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQ
SVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVE
IVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcttcacgcctgacgagatgagccgcggcggggatgcggccgccgcagtggcc
gcagtggtcgctgccgcggccgccgccgcctcggcggggaacgggaccggcgcgggcacc
ggggctgaggtgccgggcgcgggggcggtctcagcggctgggcccccgggggcggccggg
ccgggccccgggcaactgtgctgcctgcgggaggatggtgagcggtgcggccgggcggca
ggcaacgccagcttcagcaagaggatccagaagagcatctcccagaagaaggtgaagatc
gagctggataagagcgcaaggcatctttacatatgtgattatcataaaaacttaattcag
agtgttcgaaacagaagaaagagaaaagggagtgatgatgatggaggtgattcacctgtt
caagatattgataccccagaggttgatttataccaattacaagtaaatacacttaggaga
tacaaaagacacttcaagctaccaaccagaccaggacttaataaagcacaacttgttgag
atagttggttgccactttaggtctattccagtgaatgaaaaagacaccttaacatatttc
atctactcagtgaagaatgacaagaacaaatcagatctcaaggttgatagtggtgttcac
tag

DBGET integrated database retrieval system