KEGG   Homo sapiens (human): 8820
Entry
8820              CDS       T01001                                 

Gene name
HESX1, ANF, CPHD5, RPX
Definition
(RefSeq) HESX homeobox 1
  KO
K09354  homeobox protein expressed in ES cells 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00254  Growth hormone deficiency
H00544  Septo-optic dysplasia
H02036  Combined pituitary hormone deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8820 (HESX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8820 (HESX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, XANF
    8820 (HESX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 8820
NCBI-ProteinID: NP_003856
OMIM: 601802
HGNC: 4877
Ensembl: ENSG00000163666
Vega: OTTHUMG00000158597
Pharos: Q9UBX0(Tbio)
UniProt: Q9UBX0 A1LQR0
LinkDB
Structure
PDB: 
2K40

Position
3p14.3
AA seq 185 aa
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCL
HVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQI
EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFN
TNLLE
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtctcccagccttcaggaaggcgctcagctcggggaaaacaaaccctcaacttgctcc
ttttcaattgagagaatcttaggactggaccagaagaaagactgtgttccattaatgaaa
ccccacaggccctgggcagacacctgcagctcatcagggaaagatggtaacttatgtcta
catgtcccaaatcctcccagtgggatttcattccctagcgtggtggatcacccaatgcca
gaagaaagagcttcgaaatatgaaaattacttttcagcctcagaaagactgtctttgaaa
agagagttgagttggtatagaggccgaagaccaagaactgcttttactcaaaaccagatt
gaagtgttagaaaatgtctttagagtaaactgctatcctggtatcgatattagagaagac
ttagctcaaaaattgaatctagaggaagacagaatccagatttggtttcaaaatcggcgt
gcaaaactgaaaaggtcccatagagaatcacagtttctaatggcgaaaaaaaatttcaac
acaaatctgctggaatag

DBGET integrated database retrieval system