KEGG   Homo sapiens (human): 8839Help
Entry
8839              CDS       T01001                                 

Gene name
CCN5, CT58, CTGF-L, WISP2
Definition
(RefSeq) cellular communication network factor 5
  KO
K23089  WNT1-inducible-signaling pathway protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    8839 (CCN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGFBP VWC TSP_1
Motif
Other DBs
NCBI-GeneID: 8839
NCBI-ProteinID: NP_001310299
OMIM: 603399
HGNC: 12770
Ensembl: ENSG00000064205
Vega: OTTHUMG00000033071
Pharos: O76076(Tbio)
UniProt: O76076
LinkDB All DBs
Position
20q13.12
AA seq 250 aa AA seqDB search
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRL
GEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQ
FSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPS
RGRSPQNSAF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcacaccgaagacccacctcctggccttctccctcctctgcctcctctcaaag
gtgcgtacccagctgtgcccgacaccatgtacctgcccctggccacctccccgatgcccg
ctgggagtacccctggtgctggatggctgtggctgctgccgggtatgtgcacggcggctg
ggggagccctgcgaccaactccacgtctgcgacgccagccagggcctggtctgccagccc
ggggcaggacccggtggccggggggccctgtgcctcttggcagaggacgacagcagctgt
gaggtgaacggccgcctgtatcgggaaggggagaccttccagccccactgcagcatccgc
tgccgctgcgaggacggcggcttcacctgcgtgccgctgtgcagcgaggatgtgcggctg
cccagctgggactgcccccaccccaggagggtcgaggtcctgggcaagtgctgccctgag
tgggtgtgcggccaaggagggggactggggacccagccccttccagcccaaggaccccag
ttttctggccttgtctcttccctgccccctggtgtcccctgcccagaatggagcacggcc
tggggaccctgctcgaccacctgtgggctgggcatggccacccgggtgtccaaccagaac
cgcttctgccgactggagacccagcgccgcctgtgcctgtccaggccctgcccaccctcc
aggggtcgcagtccacaaaacagtgccttctag

DBGET integrated database retrieval system