KEGG   Homo sapiens (human): 8840Help
Entry
8840              CDS       T01001                                 

Gene name
CCN4, WISP1, WISP1-OT1, WISP1-UT1, WISP1c, WISP1i, WISP1tc
Definition
(RefSeq) cellular communication network factor 4
  KO
K22471  WNT1-inducible-signaling pathway protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8840 (CCN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGFBP VWC Cys_knot TSP_1
Motif
Other DBs
NCBI-GeneID: 8840
NCBI-ProteinID: NP_003873
OMIM: 603398
HGNC: 12769
Ensembl: ENSG00000104415
Vega: OTTHUMG00000164440
Pharos: O95388(Tbio)
UniProt: O95388
LinkDB All DBs
Position
8q24.22
AA seq 367 aa AA seqDB search
MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPP
RCPLGVSLITDGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVG
VGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCC
EQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSPCSTSCGLGVSTRISN
VNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYP
DFSEIAN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggttcctgccctggacgctggcagcagtgacagcagcagccgccagcaccgtc
ctggccacggccctctctccagcccctacgaccatggactttaccccagctccactggag
gacacctcctcacgcccccaattctgcaagtggccatgtgagtgcccgccatccccaccc
cgctgcccgctgggggtcagcctcatcacagatggctgtgagtgctgtaagatgtgcgct
cagcagcttggggacaactgcacggaggctgccatctgtgacccccaccggggcctctac
tgtgactacagcggggaccgcccgaggtacgcaataggagtgtgtgcacaggtggtcggt
gtgggctgcgtcctggatggggtgcgctacaacaacggccagtccttccagcctaactgc
aagtacaactgcacgtgcatcgacggcgcggtgggctgcacaccactgtgcctccgagtg
cgccccccgcgtctctggtgcccccacccgcggcgcgtgagcatacctggccactgctgt
gagcagtgggtatgtgaggacgacgccaagaggccacgcaagaccgcaccccgtgacaca
ggagccttcgatgctgtgggtgaggtggaggcatggcacaggaactgcatagcctacaca
agcccctggagcccttgctccaccagctgcggcctgggggtctccactcggatctccaat
gttaacgcccagtgctggcctgagcaagagagccgcctctgcaacttgcggccatgcgat
gtggacatccatacactcattaaggcagggaagaagtgtctggctgtgtaccagccagag
gcatccatgaacttcacacttgcgggctgcatcagcacacgctcctatcaacccaagtac
tgtggagtttgcatggacaataggtgctgcatcccctacaagtctaagactatcgacgtg
tccttccagtgtcctgatgggcttggcttctcccgccaggtcctatggattaatgcctgc
ttctgtaacctgagctgtaggaatcccaatgacatctttgctgacttggaatcctaccct
gacttctcagaaattgccaactag

DBGET integrated database retrieval system