KEGG   Homo sapiens (human): 885
Entry
885               CDS       T01001                                 

Gene name
CCK
Definition
(RefSeq) cholecystokinin
  KO
K05226  cholecystokinin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04911  Insulin secretion
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    885 (CCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    885 (CCK)
  09154 Digestive system
   04972 Pancreatic secretion
    885 (CCK)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 885
NCBI-ProteinID: NP_000720
OMIM: 118440
HGNC: 1569
Ensembl: ENSG00000187094
Vega: OTTHUMG00000131796
Pharos: P06307(Tbio)
CPD: C16114 C16133
UniProt: P06307 Q6FG82
LinkDB
Position
3p22.1
AA seq 115 aa
MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGA
LLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaacagcggcgtgtgcctgtgcgtgctgatggcggtactggcggctggcgccctgacg
cagccggtgcctcccgcagatcccgcgggctccgggctgcagcgggcagaggaggcgccc
cgtaggcagctgagggtatcgcagagaacggatggcgagtcccgagcgcacctgggcgcc
ctgctggcaagatacatccagcaggcccggaaagctccttctggacgaatgtccatcgtt
aagaacctgcagaacctggaccccagccacaggataagtgaccgggactacatgggctgg
atggattttggccgtcgcagtgccgaggagtatgagtacccctcctag

DBGET integrated database retrieval system