KEGG   Homo sapiens (human): 889Help
Entry
889               CDS       T01001                                 

Gene name
KRIT1, CAM, CCM1
Definition
(RefSeq) KRIT1 ankyrin repeat containing
  KO
K17705  Krev interaction trapped protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Disease
H00534  Cerebral cavernous malformation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    889 (KRIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX_5 FERM_M Ank_2 Ank_5 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 889
NCBI-ProteinID: NP_004903
OMIM: 604214
HGNC: 1573
Ensembl: ENSG00000001631 ENSG00000285953
Vega: OTTHUMG00000131187
Pharos: O00522(Tbio)
UniProt: O00522 A4D1F7
LinkDB All DBs
Structure
PDB: 

Position
7q21.2
AA seq 736 aa AA seqDB search
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLHEVPIEGQKKKRKKVLLETKLQG
NSEITQGILDYVVETTKPISPANQGIRGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYTYTPGCPIFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGD
SELLSRLLSERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPETDRHITDQQGRSPLNICEENKQNNWEEAAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEVEKQIEDPLAILILFDEARYNLL
KGFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYV
GVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSFIVHTKQAGLVVK
LLMKLNGQLMPTERNS
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatccagaaaacatagaagatgcatatgttgctgttattcgtccaaagaatact
gccagtctcaattctcgggaatacagagctaagtcatatgaaattttgttgcatgaagtt
cccattgaaggacagaaaaaaaagagaaagaaagttttattggaaacgaaacttcaaggc
aacagtgaaataacacaaggcatattggattacgtagtagaaaccaccaaaccaatttct
cctgcaaaccagggtatcagaggaaaacgagttgtactaatgaaaaaatttcctctggat
ggagagaagatgggcagagaagcatcattatttattgttccatcagttgtcaaagataat
actaaatacacatataccccaggatgcccaattttttactgcttacaagatattatgcga
gtctgtagtgaatccagtactcattttgctacacttacagcaaggatgttaatagccttg
gataagtggttagatgaacgtcatgcacaatctcactttattccagctttattccgacct
tctcctcttgagcggataaaaactaatgtcataaatcctgcatatgctactgaatcaggt
cagacagaaaactcactacatatgggctatagtgcactagaaataaagagtaaaatgtta
gccctagagaaagcagatacctgtatttacaaccctttgtttggatcagatcttcagtat
acaaatcgggtagataaagtggtaataaatccatactttggtctaggagctccagactac
tcaaaaatccaaatacctaaacaggaaaaatggcagagaagcatgagcagtgtcacagaa
gacaaggaacgacagtgggtagatgattttcctctccaccgaagcgcctgtgaaggagat
tcagaattactaagccgtcttctcagtgaaagattttcagtcaaccagttagatagtgac
cactgggcacccattcattatgcatgctggtatggaaaagttgaggccactcgcatattg
ttagagaaaggaaagtgcaatccaaaccttttaaatggacaacttagttctcctcttcat
tttgctgctggaggaggacatgctgaaatagtacagattctcctaaaccacccagaaacg
gatagacatataacagaccaacaaggaagatctccattaaatatttgtgaagaaaacaaa
caaaacaactgggaagaagctgcaaaattgttgaaggaagcaattaacaaaccatatgaa
aaagttcgaatatacagaatggatgggtcatatcgttctgttgaattgaagcatggaaat
aataccacagtgcagcagataatggaaggaatgcgtctctctcaagaaactcagcaatat
ttcactatatggatttgttcagaaaacctcagccttcaactcaaaccatatcataaaccc
ttgcaacatgttcgtgactggccagaaatacttgctgaattgactaatctggatcctcaa
agggaaacacctcagctttttctaagaagagatgtgagacttcccttggaagttgaaaaa
cagattgaagacccactagctattcttattctctttgatgaagccagatataatttattg
aagggcttttatacagctcctgatgctaagctgataacattggcaagtctgcttttgcaa
atagtctatggaaattatgagagtaaaaaacacaagcaaggtttcctaaatgaagaaaat
ctaaaatccatcgtacctgttaccaaactgaaaagtaaggcacctcactggacaaatcgc
atacttcatgaatacaagaatctcagtacaagtgaaggtgtcagtaaagaaatgcatcac
cttcagcgcatgttcttacagaattgctgggaaattcctacttatggagcagcatttttc
acaggacagatatttacaaaggcaagccccagcaatcataaagtcatccctgtgtatgta
ggagtgaatataaaaggacttcatctcctcaacatggaaactaaggctttactcatcagt
cttaagtatggttgttttatgtggcaattgggagatactgatacttgttttcagatccat
agcatggaaaataaaatgagctttatagtacatacaaaacaggctggtctcgtggtaaaa
ctgttaatgaagctaaatggacagttaatgcccactgaaagaaattcatga

DBGET integrated database retrieval system