KEGG   Homo sapiens (human): 890Help
Entry
890               CDS       T01001                                 

Gene name
CCNA2, CCN1, CCNA
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04152  AMPK signaling pathway
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00091  p27-Cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    890 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    890 (CCNA2)
   04218 Cellular senescence
    890 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    890 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    890 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    890 (CCNA2)
   05161 Hepatitis B
    890 (CCNA2)
   05169 Epstein-Barr virus infection
    890 (CCNA2)
   05165 Human papillomavirus infection
    890 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    890 (CCNA2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    890 (CCNA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    890 (CCNA2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    890 (CCNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C Sororin
Motif
Other DBs
NCBI-GeneID: 890
NCBI-ProteinID: NP_001228
OMIM: 123835
HGNC: 1578
Ensembl: ENSG00000145386
Vega: OTTHUMG00000133072
Pharos: P20248(Tchem)
UniProt: P20248
LinkDB All DBs
Structure
PDB: 

Position
4q27
AA seq 432 aa AA seqDB search
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcaactctgcgccggggcctgcgacccgcgaggcgggctcggcgctgctagca
ttgcagcagacggcgctccaagaggaccaggagaatatcaacccggaaaaggcagcgccc
gtccaacaaccgcggacccgggccgcgctggcggtactgaagtccgggaacccgcggggt
ctagcgcagcagcagaggccgaagacgagacgggttgcaccccttaaggatcttcctgta
aatgatgagcatgtcaccgttcctccttggaaagcaaacagtaaacagcctgcgttcacc
attcatgtggatgaagcagaaaaagaagctcagaagaagccagctgaatctcaaaaaata
gagcgtgaagatgccctggcttttaattcagccattagtttacctggacccagaaaacca
ttggtccctcttgattatccaatggatggtagttttgagtcaccacatactatggacatg
tcaattatattagaagatgaaaagccagtgagtgttaatgaagtaccagactaccatgag
gatattcacacataccttagggaaatggaggttaaatgtaaacctaaagtgggttacatg
aagaaacagccagacatcactaacagtatgagagctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggttcctgtcttccatgtcagtgctgagaggaaaacttcagcttgtgggcactgctgct
atgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagagtttgtgtac
attacagatgatacctacaccaagaaacaagttctgagaatggagcatctagttttgaaa
gtccttacttttgacttagctgctccaacagtaaatcagtttcttacccaatactttctg
catcagcagcctgcaaactgcaaagttgaaagtttagcaatgtttttgggagaattaagt
ttgatagatgctgacccatacctcaagtatttgccatcagttattgctggagctgccttt
catttagcactctacacagtcacgggacaaagctggcctgaatcattaatacgaaagact
ggatataccctggaaagtcttaagccttgtctcatggaccttcaccagacctacctcaaa
gcaccacagcatgcacaacagtcaataagagaaaagtacaaaaattcaaagtatcatggt
gtttctctcctcaacccaccagagacactaaatctgtaa

KEGG   Homo sapiens (human): 8900Help
Entry
8900              CDS       T01001                                 

Gene name
CCNA1, CT146
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04152  AMPK signaling pathway
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05221  Acute myeloid leukemia
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06275  Acute myeloid leukemia
  Element
N00091  p27-Cell cycle G1/S
N00109  PML-RARA fusion to transcriptional activtion
N00110  PLZF-RARA fusion to transcriptional activtion
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    8900 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8900 (CCNA1)
   04218 Cellular senescence
    8900 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8900 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8900 (CCNA1)
   05202 Transcriptional misregulation in cancer
    8900 (CCNA1)
   05203 Viral carcinogenesis
    8900 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    8900 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8900 (CCNA1)
   05161 Hepatitis B
    8900 (CCNA1)
   05169 Epstein-Barr virus infection
    8900 (CCNA1)
   05165 Human papillomavirus infection
    8900 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    8900 (CCNA1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8900 (CCNA1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    8900 (CCNA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    8900 (CCNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Motif
Other DBs
NCBI-GeneID: 8900
NCBI-ProteinID: NP_003905
OMIM: 604036
HGNC: 1577
Ensembl: ENSG00000133101
Vega: OTTHUMG00000016733
Pharos: P78396(Tbio)
UniProt: P78396
LinkDB All DBs
Position
13q13.3
AA seq 465 aa AA seqDB search
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVA
RGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKK
ALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFN
TVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDIT
EGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVR
TENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggagaccggctttcccgcaatcatgtaccctggatcttttattgggggctggggagaa
gagtatctcagctgggaaggaccggggctcccagatttcgtcttccagcagcagcccgtg
gagtctgaagcaatgcactgcagcaaccccaagagtggagttgtgctggctacagtggcc
cgaggtcccgatgcttgtcagatactcaccagagccccgctgggccaggatcccccgcag
aggacagtgctagggctgctaactgcaaatgggcagtacaggaggacctgtggccagggg
atcacaagaatcaggtgttattctggatcagaaaatgccttccctccagctggaaagaaa
gcactccctgactgtggggtccaagagccccccaagcaagggtttgacatctacatggat
gaactagagcagggggacagagacagctgctcggtcagagaggggatggcatttgaggat
gtgtatgaagtagacaccggcacactcaagtcagacctgcacttcctgctggatttcaac
acagtttcccctatgctggtagattcatctctcctctcccagtctgaagatatatccagt
cttggcacagatgtgataaatgtgactgaatatgctgaagaaatttatcagtaccttagg
gaagctgaaataaggcacagacccaaagcacactacatgaagaagcagccagacatcacg
gaaggcatgcgcacgattctggtggactggctggtggaggttggggaagaatataaactt
cgagcagagaccctgtatctggctgtcaacttcctggacaggttcctttcatgtatgtct
gttctgagagggaaactgcagctcgtaggaacagcagctatgcttttggcttcgaaatat
gaagagatatatcctcctgaagtagacgagtttgtctatatcaccgatgatacatacaca
aaacgacaactgttaaaaatggaacacttgcttctgaaagttctagcttttgatctgaca
gtaccaaccaccaaccagtttctccttcagtacttgaggcgacaaggagtgtgcgtcagg
actgagaacctggctaagtacgtagcagagctgagtctacttgaagcagatccattcttg
aaatatcttccttcactgatagctgcagcagctttttgcctggcaaactatactgtgaac
aagcacttttggccagaaacccttgctgcatttacagggtattcattaagtgaaattgtg
ccttgcctgagtgagcttcataaagcgtaccttgatataccccatcgacctcagcaagca
attagggagaagtacaaggcttcaaagtacctgtgtgtgtccctcatggagccacctgca
gttcttcttctacaataa

KEGG   Homo sapiens (human): 898Help
Entry
898               CDS       T01001                                 

Gene name
CCNE1, CCNE, pCCNE1
Definition
(RefSeq) cyclin E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04934  Cushing syndrome
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00255  Amplified CCNE to cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00360  HPV E7 to p27-cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
N00537  HBV HBx to cell cycle G1/S
Disease
H00018  Gastric cancer
H00055  Laryngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    898 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    898 (CCNE1)
   04114 Oocyte meiosis
    898 (CCNE1)
   04115 p53 signaling pathway
    898 (CCNE1)
   04218 Cellular senescence
    898 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    898 (CCNE1)
   05206 MicroRNAs in cancer
    898 (CCNE1)
   05203 Viral carcinogenesis
    898 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    898 (CCNE1)
   05215 Prostate cancer
    898 (CCNE1)
   05222 Small cell lung cancer
    898 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    898 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    898 (CCNE1)
   05162 Measles
    898 (CCNE1)
   05161 Hepatitis B
    898 (CCNE1)
   05169 Epstein-Barr virus infection
    898 (CCNE1)
   05165 Human papillomavirus infection
    898 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    898 (CCNE1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    898 (CCNE1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    898 (CCNE1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    898 (CCNE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 898
NCBI-ProteinID: NP_001229
OMIM: 123837
HGNC: 1589
Ensembl: ENSG00000105173
Vega: OTTHUMG00000177626
Pharos: P24864(Tchem)
UniProt: P24864
LinkDB All DBs
Structure
PDB: 

Position
19q12
AA seq 410 aa AA seqDB search
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggc
ggcgcggagttctcggctcgctccaggaagaggaaggcaaacgtgaccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtgggagccag
ccttgggacaataatgcagtctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgaccgggtttacccaaactcaacgtgcaagcctcggattattgcaccatcc
agaggctccccgctgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcacagggagaccttttacttggcacaagatttctttgaccggtatatggcgacacaa
gaaaatgttgtaaaaactcttttacagcttattgggatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcgtatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgttggatctctgtgtcctggatgttgactgccttgaatttccttatggtatacttgct
gcttcggccttgtatcatttctcgtcatctgaattgatgcaaaaggtttcagggtatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
acggggagctcaaaactgaagcacttcaggggcgtcgctgatgaagatgcacacaacata
cagacccacagagacagcttggatttgctggacaaagcccgagcaaagaaagccatgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcaccccgccacagagcggt
aagaagcagagcagcgggccggaaatggcgtga

KEGG   Homo sapiens (human): 9134Help
Entry
9134              CDS       T01001                                 

Gene name
CCNE2, CYCE2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04934  Cushing syndrome
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00359  HPV E7 to p27-cell cycle G1/S
N00360  HPV E7 to p27-cell cycle G1/S
N00482  EBV EBNA3C to p27-Cell cycle G1/S
N00496  MDM2-p21-Cell cycle G1/S
N00497  HTLV-1 Tax to p21-cell cycle G1/S
N00498  HTLV-1 Tax to p21-cell cycle G1/S
N00536  MDM2-p21-Cell cycle G1/S
N00537  HBV HBx to cell cycle G1/S
Disease
H00055  Laryngeal cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    9134 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9134 (CCNE2)
   04114 Oocyte meiosis
    9134 (CCNE2)
   04115 p53 signaling pathway
    9134 (CCNE2)
   04218 Cellular senescence
    9134 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9134 (CCNE2)
   05206 MicroRNAs in cancer
    9134 (CCNE2)
   05203 Viral carcinogenesis
    9134 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    9134 (CCNE2)
   05215 Prostate cancer
    9134 (CCNE2)
   05222 Small cell lung cancer
    9134 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    9134 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    9134 (CCNE2)
   05162 Measles
    9134 (CCNE2)
   05161 Hepatitis B
    9134 (CCNE2)
   05169 Epstein-Barr virus infection
    9134 (CCNE2)
   05165 Human papillomavirus infection
    9134 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    9134 (CCNE2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9134 (CCNE2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    9134 (CCNE2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    9134 (CCNE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 9134
NCBI-ProteinID: NP_477097
OMIM: 603775
HGNC: 1590
Ensembl: ENSG00000175305
Vega: OTTHUMG00000164696
Pharos: O96020(Tbio)
UniProt: O96020 A0A024R9B0
LinkDB All DBs
Position
8q22.1
AA seq 404 aa AA seqDB search
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK
ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP
VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA
LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH
TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagccccagcccagccagacggaa
tccccccaagaagcccagataatccaggccaagaagaggaaaactacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaattgttggccacct
gtattatctggggggatcagtccttgcattatcattgaaacacctcacaaagaaatagga
acaagtgatttctccagatttacaaattacagatttaaaaatctttttattaatccttca
cctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgttaaaaaag
gagagcagatatgttcatgacaaacattttgaagttctgcattctgacttggaaccacag
atgaggtccatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaacttgag
gaaatctatgctcctaaactccaagagtttgcttacgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgtcct
gtaacaatcatctcctggctaaatctctttctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagcttttagat
ctgtgtattctagccattgattcattagagttccagtacagaatactgactgctgctgcc
ttgtgccattttacctccattgaagtggttaagaaagcctcaggtttggagtgggacagt
atttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtactagtcca
gtgaagctgaagacttttaagaagattcctatggaagacagacataatatccagacacat
acaaactatttggctatgctggaggaagtaaattacataaacaccttcagaaaaggggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system