KEGG   Homo sapiens (human): 891Help
Entry
891               CDS       T01001                                 

Gene name
CCNB1, CCNB
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06230  Cell cycle G1/S
  Element
N00455  CDC25-Cell cycle G2/M
N00456  HIV Vpr to CDC25-cell cycle G2M
N00457  HIV Vpr to cell cycle G2M
N00458  HIV Vpr to CDC25-cell cycle G2M
N00459  WEE1-Cell cycle G2/M
N00460  HIV Vpr to WEE1-cell cycle G2M
N00499  ATR-p21-Cell cycle G2/M
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    891 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    891 (CCNB1)
   04114 Oocyte meiosis
    891 (CCNB1)
   04115 p53 signaling pathway
    891 (CCNB1)
   04218 Cellular senescence
    891 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    891 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    891 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    891 (CCNB1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    891 (CCNB1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    891 (CCNB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    891 (CCNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C Adeno_E1A TonB_N Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 891
NCBI-ProteinID: NP_114172
OMIM: 123836
HGNC: 1579
Ensembl: ENSG00000134057
Vega: OTTHUMG00000097817
Pharos: P14635(Tchem)
UniProt: P14635
LinkDB All DBs
Structure
PDB: 

Position
5q13.2
AA seq 433 aa AA seqDB search
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaactcgaaaattaatgctgaaaataaggcgaagatcaac
atggcaggcgcaaagcgcgttcctacggcccctgctgcaacctccaagcccggactgagg
ccaagaacagctcttggggacattggtaacaaagtcagtgaacaactgcaggccaaaatg
cctatgaagaaggaagcaaaaccttcagctactggaaaagtcattgataaaaaactacca
aaacctcttgaaaaggtacctatgctggtgccagtgccagtgtctgagccagtgccagag
ccagaacctgagccagaacctgagcctgttaaagaagaaaaactttcgcctgagcctatt
ttggttgatactgcctctccaagcccaatggaaacatctggatgtgcccctgcagaagaa
gacctgtgtcaggctttctctgatgtaattcttgcagtaaatgatgtggatgcagaagat
ggagctgatccaaacctttgtagtgaatatgtgaaagatatttatgcttatctgagacaa
cttgaggaagagcaagcagtcagaccaaaatacctactgggtcgggaagtcactggaaac
atgagagccatcctaattgactggctagtacaggttcaaatgaaattcaggttgttgcag
gagaccatgtacatgactgtctccattattgatcggttcatgcagaataattgtgtgccc
aagaagatgctgcagctggttggtgtcactgccatgtttattgcaagcaaatatgaagaa
atgtaccctccagaaattggtgactttgcttttgtgactgacaacacttatactaagcac
caaatcagacagatggaaatgaagattctaagagctttaaactttggtctgggtcggcct
ctacctttgcacttccttcggagagcatctaagattggagaggttgatgtcgagcaacat
actttggccaaatacctgatggaactaactatgttggactatgacatggtgcactttcct
ccttctcaaattgcagcaggagctttttgcttagcactgaaaattctggataatggtgaa
tggacaccaactctacaacattacctgtcatatactgaagaatctcttcttccagttatg
cagcacctggctaagaatgtagtcatggtaaatcaaggacttacaaagcacatgactgtc
aagaacaagtatgccacatcgaagcatgctaagatcagcactctaccacagctgaattct
gcactagttcaagatttagccaaggctgtggcaaaggtgtaa

DBGET integrated database retrieval system