KEGG   Homo sapiens (human): 894Help
Entry
894               CDS       T01001                                 

Gene name
CCND2, KIAK0002, MPPH3
Definition
(RefSeq) cyclin D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00123  Amplified REL to transcription
N00124  IGH-MAF fusion to transcriptional activation
N00125  IGH-MMSET fusion to transcriptional activation
N00347  p300-p21-Cell cycle G1/S
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00358  HPV E6 to p21-cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
N00420  HCMV IE2-86 to p21-cell cycle G1/S
N00421  HCMV IE2-86 to p21-cell cycle G1/S
N00483  EBV EBNA3C to cell cycle G1/S
N00489  HTLV-1 p30II to c-myc-mediated transcription
N00494  HTLV-1 Tax to p16-cell cycle G1/S
N00495  HTLV-1 Tax to p15-cell cycle G1/S
Disease
H00023  Testicular cancer
H01885  Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    894 (CCND2)
   04340 Hedgehog signaling pathway
    894 (CCND2)
   04390 Hippo signaling pathway
    894 (CCND2)
   04630 Jak-STAT signaling pathway
    894 (CCND2)
   04068 FoxO signaling pathway
    894 (CCND2)
   04151 PI3K-Akt signaling pathway
    894 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    894 (CCND2)
   04115 p53 signaling pathway
    894 (CCND2)
   04218 Cellular senescence
    894 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    894 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    894 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    894 (CCND2)
   05202 Transcriptional misregulation in cancer
    894 (CCND2)
   05206 MicroRNAs in cancer
    894 (CCND2)
   05203 Viral carcinogenesis
    894 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    894 (CCND2)
   05162 Measles
    894 (CCND2)
   05169 Epstein-Barr virus infection
    894 (CCND2)
   05165 Human papillomavirus infection
    894 (CCND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 894
NCBI-ProteinID: NP_001750
OMIM: 123833
HGNC: 1583
Ensembl: ENSG00000118971
Vega: OTTHUMG00000168123
Pharos: P30279(Tbio)
UniProt: P30279
LinkDB All DBs
Position
12p13.32
AA seq 289 aa AA seqDB search
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDV
DCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgccacgaggtggacccggtccgcagggccgtgcgggaccgcaacctg
ctccgagacgaccgcgtcctgcagaacctgctcaccatcgaggagcgctaccttccgcag
tgctcctacttcaagtgcgtgcagaaggacatccaaccctacatgcgcagaatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgcgaagaagaggtcttccctctggcc
atgaattacctggaccgtttcttggctggggtcccgactccgaagtcccatctgcaactc
ctgggtgctgtctgcatgttcctggcctccaaactcaaagagaccagcccgctgaccgcg
gagaagctgtgcatttacaccgacaactccatcaagcctcaggagctgctggagtgggaa
ctggtggtgctggggaagttgaagtggaacctggcagctgtcactcctcatgacttcatt
gagcacatcttgcgcaagctgccccagcagcgggagaagctgtctctgatccgcaagcat
gctcagaccttcattgctctgtgtgccaccgactttaagtttgccatgtacccaccgtcg
atgatcgcaactggaagtgtgggagcagccatctgtgggctccagcaggatgaggaagtg
agctcgctcacttgtgatgccctgactgagctgctggctaagatcaccaacacagacgtg
gattgtctcaaagcttgccaggagcagattgaggcggtgctcctcaatagcctgcagcag
taccgtcaggaccaacgtgacggatccaagtcggaggatgaactggaccaagccagcacc
cctacagacgtgcgggatatcgacctgtga

KEGG   Homo sapiens (human): 3695Help
Entry
3695              CDS       T01001                                 

Gene name
ITGB7
Definition
(RefSeq) integrin subunit beta 7
  KO
K06590  integrin beta 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06240  Transcription
  Element
N00124  IGH-MAF fusion to transcriptional activation
N00393  ITGA/B-RhoA signaling pathway
Drug target
Abrilumab: D10540
Etrolizumab: D09901
Valategrast hydrochloride: D10028
Vedolizumab: D08083
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3695 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3695 (ITGB7)
   04514 Cell adhesion molecules (CAMs)
    3695 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3695 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3695 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    3695 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3695 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3695 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    3695 (ITGB7)
   05414 Dilated cardiomyopathy (DCM)
    3695 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3695 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3695 (ITGB7)
   04515 Cell adhesion molecules [BR:hsa04515]
    3695 (ITGB7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3695 (ITGB7)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3695 (ITGB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 3695
NCBI-ProteinID: NP_000880
OMIM: 147559
HGNC: 6162
Ensembl: ENSG00000139626
Vega: OTTHUMG00000169775
Pharos: P26010(Tclin)
UniProt: P26010
LinkDB All DBs
Structure
PDB: 

Position
12q13.13
AA seq 798 aa AA seqDB search
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggtggctttgccaatggtccttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggacgccaagatcccatccacaggggatgccacagaatggcggaatcctcacctgtcc
atgctggggtcctgccagccagccccctcctgccagaagtgcatcctctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggagaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgctgcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaacg
gtgctgccctttgtgagcacagtaccctccaaactgcgccacccctgccccacccggctg
gagcgctgccagtcaccattcagctttcaccatgtgctgtccctgacgggggacgcacaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcgcctgaaggt
ggcttcgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagacgacacattccatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagca
aatatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctgagt
aaactgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaattgcagtgac
acccagccccaggctccccactgcagtgatggccagggacacctacaatgtggtgtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggcagagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagctctgggcatctgtgcgag
tgtgacgatgccagctgtgagcgacatgagggcatcctctgcggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggacggctactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtggggccttcaggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagcggaccctggacaaccagctgttcttcttc
ttggtggaggatgacgccagaggcacggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacgcaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

DBGET integrated database retrieval system