KEGG   Homo sapiens (human): 8945
Entry
8945              CDS       T01001                                 

Gene name
BTRC, BETA-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, bTrCP, bTrCP1, betaTrCP
Definition
(RefSeq) beta-transducin repeat containing E3 ubiquitin protein ligase
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04710  Circadian rhythm
hsa05131  Shigellosis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06123  TNF signaling (viruses and bacteria)
  Element
N00942  Shigella OspG to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8945 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8945 (BTRC)
   04340 Hedgehog signaling pathway
    8945 (BTRC)
   04390 Hippo signaling pathway
    8945 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    8945 (BTRC)
   04218 Cellular senescence
    8945 (BTRC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8945 (BTRC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8945 (BTRC)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8945 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8945 (BTRC)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8945 (BTRC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     8945 (BTRC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     8945 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 PAN_3 DUF4508 WD40_2
Other DBs
NCBI-GeneID: 8945
NCBI-ProteinID: NP_378663
OMIM: 603482
HGNC: 1144
Ensembl: ENSG00000166167
Vega: OTTHUMG00000018932
Pharos: Q9Y297(Tbio)
UniProt: Q9Y297 B2R8L3 A0A0S2Z4P6 Q68DS0
LinkDB
Structure
PDB: 

Position
10q24.32
AA seq 605 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
TYISR
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaagagaaggcactcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctg
tataacccagggactggcgcactcacagctttccagaattcctcagagagagaagactgt
aataatggcgaaccccctaggaagataataccagagaagaattcacttagacagacatac
aacagctgtgccagactctgcttaaaccaagaaacagtatgtttagcaagcactgctatg
aagactgagaattgtgtggccaaaacaaaacttgccaatggcacttccagtatgattgtg
cccaagcaacggaaactctcagcaagctatgaaaaggaaaaggaactgtgtgtcaaatac
tttgagcagtggtcagagtcagatcaagtggaatttgtggaacatcttatatcccaaatg
tgtcattaccaacatgggcacataaactcgtatcttaaacctatgttgcagagagatttc
ataactgctctgccagctcggggattggatcatattgctgagaacattctgtcatacctg
gatgccaaatcactatgtgctgctgaacttgtgtgcaaggaatggtaccgagtgacctct
gatggcatgctgtggaagaagcttatcgagagaatggtcaggacagattctctgtggaga
ggcctggcagaacgaagaggatggggacagtatttattcaaaaacaaacctcctgacggg
aatgctcctcccaactctttttatagagcactttatcctaaaattatacaagacattgag
acaatagaatctaattggagatgtggaagacatagtttacagagaattcactgccgaagt
gaaacaagcaaaggagtttactgtttacagtatgatgatcagaaaatagtaagcggcctt
cgagacaacacaatcaagatctgggataaaaacacattggaatgcaagcgaattctcaca
ggccatacaggttcagtcctctgtctccagtatgatgagagagtgatcataacaggatca
tcggattccacggtcagagtgtgggatgtaaatacaggtgaaatgctaaacacgttgatt
caccattgtgaagcagttctgcacttgcgtttcaataatggcatgatggtgacctgctcc
aaagatcgttccattgctgtatgggatatggcctccccaactgacattaccctccggagg
gtgctggtcggacaccgagctgctgtcaatgttgtagactttgatgacaagtacattgtt
tctgcatctggggatagaactataaaggtatggaacacaagtacttgtgaatttgtaagg
accttaaatggacacaaacgaggcattgcctgtttgcagtacagggacaggctggtagtg
agtggctcatctgacaacactatcagattatgggacatagaatgtggtgcatgtttacga
gtgttagaaggccatgaggaattggtgcgttgtattcgatttgataacaagaggatagtc
agtggggcctatgatggaaaaattaaagtgtgggatcttgtggctgctttggacccccgt
gctcctgcagggacactctgtctacggacccttgtggagcattccggaagagtttttcga
ctacagtttgatgaattccagattgtcagtagttcacatgatgacacaatcctcatctgg
gacttcctaaatgatccagctgcccaagctgaacccccccgttccccttctcgaacatac
acctacatctccagataa

DBGET integrated database retrieval system