KEGG   Homo sapiens (human): 896Help
Entry
896               CDS       T01001                                 

Gene name
CCND3
Definition
(RefSeq) cyclin D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04630  Jak-STAT signaling pathway
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle G1/S
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00347  p300-p21-Cell cycle G1/S
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00358  HPV E6 to p21-cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
N00420  HCMV IE2-86 to p21-cell cycle G1/S
N00421  HCMV IE2-86 to p21-cell cycle G1/S
N00483  EBV EBNA3C to cell cycle G1/S
N00494  HTLV-1 Tax to p16-cell cycle G1/S
N00495  HTLV-1 Tax to p15-cell cycle G1/S
N00741  IAV M2 to cell cycle G1/S
Disease
H00010  Multiple myeloma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    896 (CCND3)
   04390 Hippo signaling pathway
    896 (CCND3)
   04630 Jak-STAT signaling pathway
    896 (CCND3)
   04151 PI3K-Akt signaling pathway
    896 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    896 (CCND3)
   04115 p53 signaling pathway
    896 (CCND3)
   04218 Cellular senescence
    896 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    896 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    896 (CCND3)
   05203 Viral carcinogenesis
    896 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    896 (CCND3)
   05162 Measles
    896 (CCND3)
   05164 Influenza A
    896 (CCND3)
   05169 Epstein-Barr virus infection
    896 (CCND3)
   05165 Human papillomavirus infection
    896 (CCND3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Motif
Other DBs
NCBI-GeneID: 896
NCBI-ProteinID: NP_001751
OMIM: 123834
HGNC: 1585
Ensembl: ENSG00000112576
Vega: OTTHUMG00000014690
Pharos: P30281(Tchem)
UniProt: P30281
LinkDB All DBs
Structure
PDB: 

Position
6p21.1
AA seq 292 aa AA seqDB search
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKML
AYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLT
IEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKK
HAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCL
RACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgttgcgaaggcacccggcacgcgccccgggccgggccggacccgcgg
ctgctgggggaccagcgtgtcctgcagagcctgctccgcctggaggagcgctacgtaccc
cgcgcctcctacttccagtgcgtgcagcgggagatcaagccgcacatgcggaagatgctg
gcttactggatgctggaggtatgtgaggagcagcgctgtgaggaggaagtcttccccctg
gccatgaactacctggatcgctacctgtcttgcgtccccacccgaaaggcgcagttgcag
ctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgagaccacgcccctgacc
atcgaaaaactgtgcatctacaccgaccacgctgtctctccccgccagttgcgggactgg
gaggtgctggtcctagggaagctcaagtgggacctggctgctgtgattgcacatgatttc
ctggccttcattctgcaccggctctctctgccccgtgaccgacaggccttggtcaaaaag
catgcccagacctttttggccctctgtgctacagattatacctttgccatgtacccgcca
tccatgatcgccacgggcagcattggggctgcagtgcaaggcctgggtgcctgctccatg
tccggggatgagctcacagagctgctggcagggatcactggcactgaagtggactgcctg
cgggcctgtcaggagcagatcgaagctgcactcagggagagcctcagggaagcctctcag
accagctccagcccagcgcccaaagccccccggggctccagcagccaagggcccagccag
accagcactcctacagatgtcacagccatacacctgtag

DBGET integrated database retrieval system