KEGG   Homo sapiens (human): 8972
Entry
8972              CDS       T01001                                 

Gene name
MGAM, MG, MGA
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
Drug target
Acarbose: D00216<JP/US>
Emiglitate: D09779
Miglitol: D00625<JP/US>
Voglibose: D01665<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    8972 (MGAM)
   00500 Starch and sucrose metabolism
    8972 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    8972 (MGAM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     8972 (MGAM)
    3.2.1.20  alpha-glucosidase
     8972 (MGAM)
SSDB
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Other DBs
NCBI-GeneID: 8972
NCBI-ProteinID: NP_004659
OMIM: 154360
HGNC: 7043
Ensembl: ENSG00000257335
Vega: OTTHUMG00000158395
Pharos: O43451(Tclin)
UniProt: O43451
LinkDB
Structure
PDB: 

Position
7q34
AA seq 1857 aa
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTP
DPGTTGTTHARTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTS
NRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLY
GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER
RDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNS
SDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGS
VSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKT
VFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICG
FALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLL
PYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAY
VPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL
IIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFN
EIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRD
EEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADIS
LKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEG
QLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHR
SYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAI
SGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYV
AFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDAS
LNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAVQEV
TGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFF
QDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLY
TLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIAL
DDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIE
IWGVGSVPVTSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWISTL
NT seq 5574 nt   +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
cttgtgttgtttatcatcagtattgttctaattgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcctgggacaactggtaccccagatcctgggacaactggtacccca
gatcctggaacaactggtaccacacatgctaggacaacgggtcccccagatcctggaaca
actggtaccactcctgtttctgctgaatgtccagtggtaaatgaattggaacgaattaat
tgcatccctgaccagccgccaacaaaggccacatgtgaccaacgtggctgttgctggaat
ccccagggagctgtaagtgttccctggtgctactattccaagaatcatagctaccatgta
gagggcaaccttgtcaacacaaatgcaggattcacagcccggttgaaaaatctgccttct
tcaccagtgtttggaagcaatgttgacaatgttcttctcacagcagaatatcagacatct
aatcgtttccactttaagttgactgaccaaaccaataacaggtttgaagtgccccacgaa
cacgtgcagtccttcagtggaaatgctgctgcttctttgacctaccaagttgaaatctcc
agacagccatttagcatcaaagtgaccagaagaagcaacaatcgtgttttgtttgactcg
agcattgggcccctactgtttgctgaccagttcttgcagctctccactcgactgcctagc
actaacgtgtatggcctgggagagcatgtgcaccagcagtatcggcatgatatgaattgg
aagacctggcccatatttaacagagacacaactcccaatggaaacggaactaatttgtat
ggtgcgcagacattcttcttgtgccttgaagatgctagtggattgtcctttggggtgttt
ctgatgaacagcaatgccatggaggttgtccttcagcctgcgccagccatcacttaccgc
accattgggggcattctcgacttctatgtgttcttgggaaacactccagagcaagttgtt
caagaatatctagagctcattgggcggccagcccttccctcctactgggcgcttggattt
cacctcagtcgttacgaatatggaaccttagacaacatgagggaagtcgtggagagaaat
cgcgcagcacagctcccttatgatgttcagcatgctgatattgattatatggatgagaga
agggacttcacttatgattcagtggattttaaaggcttccctgaatttgtcaacgagtta
cacaataatggacagaagcttgtcatcattgtggatccagccatctccaacaactcttcc
tcaagtaaaccctatggcccatatgacaggggttcagatatgaagatatgggtgaatagt
tcagatggagtgactccactcattggggaggtctggcctggacaaactgtgtttcctgat
tataccaatcccaactgtgctgtttggtggacaaaggaatttgagctttttcacaatcaa
gtagagtttgatggaatctggattgatatgaatgaagtctccaactttgttgatggttcg
gtctcaggatgttccacaaacaacctaaataatcccccattcactcccagaatcctggat
gggtacctgttctgcaagactctctgtatggatgcagtgcagcactggggcaagcagtat
gacattcacaatctgtatggctactccatggcggtcgccacagcagaagctgccaagact
gtgttccctaataagagaagcttcattctgacccgttctacctttgcgggctctggcaag
tttgcagcacattggttaggagacaacactgccacctgggatgacctgagatggtccatc
cctggcgtgcttgagttcaacctttttggcatcccaatggtgggtcctgacatatgtggc
tttgctttggacacccctgaggagctctgtaggcggtggatgcagttgggtgcattttat
ccgttttctagaaatcacaatggccaaggctacaaggaccaggatcctgcctcctttgga
gctgactccctgctgttgaattcctccaggcactaccttaacatccgctatactctattg
ccctacctatacaccctcttcttccgtgctcacagccgaggggacacggtggccaggccc
cttttgcatgagttctacgaggacaacagcacttgggatgtgcaccaacagttcttatgg
gggcccggcctcctcatcactccagttctggatgaaggtgcagagaaagtgatggcatat
gtgcctgatgctgtctggtatgactacgagactgggagccaagtgagatggaggaagcaa
aaagtcgagatggaacttcctggagacaaaattggacttcaccttcgaggaggctacatc
ttccccacacagcagccaaatacaaccactctggccagtcgaaagaaccctcttggtctt
atcattgccctagatgagaacaaagaagcaaaaggagaacttttctgggataatggggaa
acgaaggatactgtggccaataaagtgtatcttttatgtgagttttctgtcactcaaaac
cgcttggaggtgaatatttcacaatcaacctacaaggaccccaataatttagcatttaat
gagattaaaattcttgggacggaggaacctagcaatgttacagtgaaacacaatggtgtc
ccaagtcagacttctcctacagtcacttatgattctaacctgaaggttgccattatcaca
gatattgatcttctcctgggagaagcatacacagtggaatggagcataaagataagggat
gaagaaaaaatagactgttaccctgatgagaatggtgcttctgccgaaaactgcactgcc
cgtggctgtatctgggaggcatccaattcttctggagtccctttttgctattttgtcaac
gacctatactctgtcagtgatgttcagtataattcccatggggccacagctgacatctcc
ttaaagtcttccgtttatgccaatgccttcccctccacacccgtgaacccccttcgcctg
gatgtcacttaccataagaatgaaatgctgcagttcaagatttatgatcccaacaagaat
cggtatgaagttccagtccctctgaacatacccagcatgccatccagcacccctgagggt
caactctatgatgtgctcattaagaagaatccatttgggattgaaattcgccggaagagt
acaggcactataatttgggactctcagctccttggctttaccttcagtgacatgtttatc
cgcatctccacccgccttccctccaagtacctctatggctttggggaaactgagcacagg
tcctataggagagacttggagtggcacacttgggggatgttctcccgagaccagccccca
gggtacaagaagaattcctatggtgtccacccctactacatggggctggaggaggacggc
agtgcccatggagtgctcctgctgaacagcaatgccatggatgtgacgttccagcccctg
cctgccttgacataccgcaccacagggggagttctggacttttatgtgttcttggggccg
actccagagcttgtcacccagcagtacactgagttgattggccggcctgtgatggtacct
tactggtctttggggttccagctgtgtcgctatggctaccagaatgactctgagatcgcc
agcttgtatgatgagatggtggctgcccagatcccttatgatgtgcagtactcagacatc
gactacatggagcggcagctggacttcaccctcagccccaagtttgctgggtttccagct
ctgatcaatcgcatgaaggctgatgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacacagccttatcctgccttcactcggggcgtggaggatgacgtcttc
atcaaatacccaaatgatggagacattgtctggggaaaggtctggcctgattttcctgat
gttgttgtgaatgggtctctagactgggacagccaagtggagctatatcgagcttatgtg
gccttcccagactttttccgtaattcaactgccaagtggtggaagagggaaatagaagaa
ctatacaacaatccacagaatccagagaggagcttgaagtttgatggcatgtggattgat
atgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgcagggacgcctct
ctgaaccaccctccctacatgccacatttggagtccagggacaggggcctgagcagcaag
accctttgtatggagagtcagcagatcctcccagacggctccctggtgcagcactacaac
gtgcacaacctgtatgggtggtcccagaccagacccacatacgaagccgtgcaggaggtg
acgggacagcgaggggtcgtcatcacccgctccacatttccctcttctggccgctgggca
ggacattggctgggagacaacacggccgcatgggatcagctgaagaagtctatcattggc
atgatggagttcagcctcttcggcatatcctatacgggagcagatatctgtgggttcttt
caagatgctgaatatgagatgtgtgttcgctggatgcagctgggggccttttaccccttc
tcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcctgggatgttgct
tttgtgaatatttccagaactgtcctgcagaccagatacaccctgttgccatatctgtat
accttgatgcataaggcccacacggagggcgtcactgttgtgcggcctctgctccatgag
tttgtgtcagaccaggtgacatgggacatagacagtcagttcctgctgggcccagccttc
ctggtcagccctgtcctggagcgtaatgccagaaatgtcactgcatatttccctagagcc
cgctggtatgattactacacgggtgtggatattaatgcaagaggagagtggaagaccttg
ccagcccctcttgaccacattaatcttcatgtccgtgggggctacatcctgccctggcaa
gagcctgcactgaacacccacttaagccgccagaaattcatgggcttcaaaattgccttg
gatgatgaaggaactgctgggggctggctcttctgggatgatgggcaaagcattgatacc
tatgggaaaggactctattacttggccagcttttctgccagccagaatacgatgcaaagc
catataattttcaacaattacatcactggtacaaatcctttgaaactgggctacattgaa
atctggggagtgggcagtgtccccgttaccagtgtcagcatctctgtgagtggcatggtc
ataacaccctccttcaacaatgaccccacgacacaggtattaagcatcgatgtgactgac
agaaacatcagcctacataattttacttcattgacgtggataagcactctgtga

KEGG   Homo sapiens (human): 93432
Entry
93432             CDS       T01001                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
hsa04973  Carbohydrate digestion and absorption
Network
nt06017  Glycogen metabolism
  Element
N00720  Glycogen degradation (amylase)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    93432 (MGAM2)
   00500 Starch and sucrose metabolism
    93432 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    93432 (MGAM2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     93432 (MGAM2)
    3.2.1.20  alpha-glucosidase
     93432 (MGAM2)
SSDB
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Other DBs
NCBI-GeneID: 93432
NCBI-ProteinID: NP_001280555
HGNC: 28101
Ensembl: ENSG00000257743
Vega: OTTHUMG00000158558
Pharos: Q2M2H8(Tdark)
UniProt: Q2M2H8
LinkDB
Position
7q34
AA seq 2515 aa
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGIADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDARGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFFPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGSNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMN
EVSSLLQASNNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGVDSLLLKSSRH
YLNIRYTLLPYLYTLFYHAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAISWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
ASRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
MDTDNLMFTDITILGMDKQPANFIVLLNNVATSSPSVVYNASTKVVTITDLQGLVLGQEF
SIRWNLPVSDLEKFNCYPDDPTASEESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLPMAPESAAAAASDSLSAKISFLHLKVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFIFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMNWNTWGMFAHDEPPAYKKNSYGVHPYYMALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFHLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSLLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSNEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSPVEHYNVHNLYG
WSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHRLGNNTAAWDQLGKSIIGMMEFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSR
KVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILISPVL
ETSTFEISAYFPRARWYDYSTGTSSTSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIVALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNILQIQTIHNK
YLSDSNPLKVGYIRIWGVNTYVTQVSFTYDNRQFMETNFKSEPYNQILTIQLTDKTINLE
KLTEVTWIDGGPVLPTPTKTSTIPMSSHPSPSTTNATSSETITSSASANTTTGTTDTVPI
TTTSFPSTTSVTTNTTVPDTTSPFPTSTTNASTNATVPITTTPFPTSTIGVTTNATVPNT
TAPFPTNASTASTNATVPITTTCFATSTIGVTTNATVPDTTAPFPTNTTTASTNATIPIT
TTPFATSTISVTTSTTVPDTTAPFPTSTTSASTNATPVPITTTLFATSTIGVTTGTTVPD
TTAPFPTSTTSTSTSATVPITTTPSPTNTADANTSNTVPNTTMPSPTSSTTVSTIATVPI
SVTPSLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVAN
ITATSHTSTDDTVPNNTVPVTAIPSLANTGVDTTSNSFSIMTTSFSESTNAMNTTVIMAT
TSPTSTDVASTNNDASMTNFLLATMSAGNITSNSISITTTSFGNSVPFVTTPSPSTDATT
TSNNTNPGMTTYYQTSPTIPTHTLTSIPSSITSILSMFPTSNTFTTDKITNFTTPTNANT
IIFNTLDTKSTMVIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFATPHSATTTTLAL
SHTSLAPTNLSNLGTMDITDADNSSSVTGNTTHISVSNLTTASVTITATGLDSQTPHMVI
NSVATYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPTYIANAINATQVP
NT seq 7548 nt   +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcatcttctgcttaattgtggtg
accatagatatcctcttgctgcttcttgtgttggaggaaacttcagatacttcatttact
ccagagtgcccagagattccccagtcggaaaggatagactgcacacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcgcctgtggcagatgccaat
gtccctaggtgcttcttcccctggaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccatcaccatctctgtttggaaat
gatgtcgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaacctggttgat
gggattgctgatgcctccaatttgagctattacgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcttgttggacacgagcatcgggcccctc
cagtttgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagagcatgtgcaccagcagtaccgccacaatatgacctggaagacttggcccatc
ttcacccgggacgctacccccaccgagggcatgattaatctgtatggagctcatacattc
ttcttgtgccttgaagatgccaggggctcctcttttggagtatttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcgatcacttatcgcacgattggaggcatt
cttgacttttacgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttccctccctattggagtcttgggttccagcttagtcgcagg
gactatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgacaatggacag
aaatatcttattattatgaatcctggcatctccaaaaactctaactacgagccctataat
aatggaagcctaaagagagtgtggatcttggggagcaatggctttgctgttggggaggga
tatccgggaccgacagtctttcccgattataccaatccagtatgcactgagtggtggaca
gatcaggtcgctaaatttcatgatcatctggagtttgatggagtgtggattgaaatgaat
gaagtatctagcttactccaagcttctaataaccagtgtgaatccaacaacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagtttcatgggggccttcattatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccatcttcatgaataataggagcttcatcttatcc
cgttctacttttgctggatctggcaaatttgctgctcattggctgggggacaatgcggcc
acatgggatgacctccgatggtctatccccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttataacaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcctgggttc
agggaccaggatcccgctgcctttggtgttgattccctgctgctgaaatcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccatgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgttttatat
gaaggtgtggacgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatctcatggaggaaacagttggtgaatatgcttctcccaggtgacaagata
ggacttcatctgcgagggggctacatatttcccactcagaagccaaacacaaccacagaa
gccagccggaggaattccctgggactcatcatcgccttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtgactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
atggacactgacaacctcatgttcacagatatcacaatcttgggaatggacaaacagcca
gctaattttatcgtcctactgaataatgttgccacctccagtccaagcgttgtctacaat
gcttccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattaggtggaatcttcctgtcagtgacctggagaagttcaactgctaccctgatgat
ccaacagcctctgaggagagttgtaggcagcgggggtgtctttgggaggacacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgttgctagtgatattcag
tacctgaacaccagcatcactgcagacctttccctcccgatggcccctgagtcagctgct
gctgccgcctctgattctctctctgcaaagatcagcttcctccacctgaaagtgatctat
cacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaaggtatgaggtt
ccagtaccactgaacacccctccccaaccagttggtgaccctgaaaaccgtctgtatgat
gtcaggattcagaacaatccttttggaatccagattcaacgcaaaaactccagcactgtg
atttgggattctcaactccctggcttcatcttcaatgacatgtttctctccatttctacg
cgtctgccgtcccagtacatctatggctttggggaaactgagcacacgactttcagaaga
aacatgaactggaacacatggggaatgtttgctcatgatgagccacctgcgtacaagaag
aattcctatggtgtccacccttactacatggcactggaggaggatggtagtgcccatgga
gtgctcctgctaaatagcaatgccatggatgtgacattacagcccactcctgctctgaca
taccgcaccacaggagggattttggacttctacattgttttggggccaacccctgaactt
gtaactcagcaatacacagagttgattggtcggccagcaatgattccatactgggccttg
ggattccatctgagtcgctatggataccagaatgatgctgaaatctccagtttgtatgat
gcaatggtggcagcccagattccctatgacgtccagcatgtagacatcgattacatgaac
cggaagctggatttcaccctcagtgccaactttcaaaacctcagtcttctgattgagcaa
atgaagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgag
acacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcctgac
accaatgacattgtctggggaaaggtttggccagatctgcctaatgtaattgtagatgga
tcccttgaccatgaaactcaggttaagctttacagggcctacgttgcctttcctgacttc
tttcgtaatagcacagctgcgtggtggaagaaagagatagaagagctctatgcaaaccct
cgagagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatca
aattttgtggatggatctgtcaggggctgcagcaatgaaatgctaaataacccaccctat
atgccatatttggaatctagggacaagggcctgagcagcaagactctgtgcatggagagt
cagcagatcctgccggacagctcccccgtggagcactacaacgtgcacaacctgtacggg
tggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtc
atcatcacccgctccacatttccctcttctggacgctggggaggacaccggttgggaaac
aacacagctgcatgggaccagctggggaaatctatcattggcatgatggagttcagtctc
tttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgag
atgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaacaac
atcgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtccaga
aaagtcctagagaccagatataccctgcttccttatctctatactctgatgcataaagct
cacgttgagggcagcacagttgtccggccccttctccatgagtttacggatgacaggaca
acatgggatatagaccgtcagttcatgttgggccctgctatcttaatcagccctgtgttg
gaaactagcacatttgagatctctgcttattttccgagagcccgttggtatgactatagc
acgggaactagcagcacatcaacaggtcagaggaaaatcctgaaggctccccttgaccac
atcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgctatgaacact
cactccagtcgacaaaattttatgggattgattgttgctttggatgacaatgggacagct
gaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaattat
tttttggcaaactttatagcagctcagaacatcctgcaaatccagaccatacacaataag
tatttgagtgactcgaatccactaaaagttgggtatattagaatctggggtgtgaatacc
tatgtgacacaagtcagtttcacctatgacaaccggcaatttatggagacaaatttcaag
agtgaaccttataatcagatactaactattcaattgactgacaagactatcaacctggaa
aagttaactgaggttacttggattgatggtggtcctgtacttcctactccaactaagaca
agtaccatcccaatgagttctcatccttctccatctactaccaatgccaccagttctgag
acaatcaccagttctgccagtgcaaatactaccactggcactactgatactgttcctatc
acaaccacatctttcccaagtactactagtgttacaactaatactactgttcctgataca
acttctcctttccctacaagtactactaatgctagcactaatgctactgttcctatcaca
accacacctttcccaacaagtactattggtgttacaactaatgctactgttcccaataca
actgcccctttcccaacaaatgctagtactgctagcactaatgctactgttcctatcaca
accacatgttttgcaacaagtactattggtgttacaactaatgctactgttcccgataca
actgcccctttcccaacaaatactactactgctagcactaatgctactattcctatcaca
accacaccttttgcaacaagtactattagtgttacaactagtactactgttcctgataca
actgctcctttccctacaagtactactagtgctagcactaatgctacccctgttcctatc
acaaccacactttttgcaacaagtactattggtgttacaactggtactactgttcctgat
acaactgctcctttccctacaagtactactagtactagcactagtgctactgttcctatt
acaaccacaccttcccctacaaatactgctgatgctaacactagtaatactgttcctaat
accactatgccttctcctacaagtagtactactgtgagtactattgctaccgttcccatt
tcagtgactccttctctgacaagtactgctgatgccaccattagtactactgtacttatt
gccactacttcttctctaacaggtactactgatgttagcactagtactactattaataat
ataagtactcctgttcaaacaaatactactaatgctagcactagtactaatgttgctaat
ataactgctacctctcatacaagtactgatgatactgttcctaataatactgttccagtt
acagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttccatt
atgaccacttctttctctgaaagtactaatgctatgaacactactgttattatggcaact
acttctcctacaagtactgatgttgctagcacaaataatgatgcttctatgacaaatttt
cttttagctacaatgtctgctggtaatataactagtaatagtatttccataacaactact
tcttttggtaatagtgttccttttgtgactactccttctccaagtactgatgctactact
acaagtaataatactaatcctggcatgactacttattaccagacttctcctaccattcct
acccatactcttacttctattcctagctctattacttctattttgagcatgtttccaaca
agtaatacattcactactgataaaattactaattttactacccctacaaatgcaaacacc
attattttcaacactcttgatacaaaaagtaccatggtaatagatgctacggtcactact
accagcaccaaagataataccatgagtccagatacaacagttacttccatagacaaattc
accacacacatcacacagttcgctactccccattctgctactactacaacactggcctta
agccacacctcattagctcctacaaatctttctaatctaggcaccatggatattactgat
gcagataactccagcagtgttacaggtaacacgacacacatttctgtttcaaatctcaca
acagcctcagtcacaataacagccactggtctagattcacaaactccccatatggtaata
aattctgtggctacttatttacctattactgcaactagtgctaccacagatactacaaat
attacaaaatatgctttaaatactaccactcctgatagtacagtacatacctctgctact
gcacctacttatattgcaaatgccataaatgctactcaagttccatga

DBGET integrated database retrieval system