KEGG   Homo sapiens (human): 89780Help
Entry
89780             CDS       T01001                                 

Gene name
WNT3A
Definition
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    89780 (WNT3A)
   04390 Hippo signaling pathway
    89780 (WNT3A)
   04150 mTOR signaling pathway
    89780 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    89780 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    89780 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    89780 (WNT3A)
   05206 MicroRNAs in cancer
    89780 (WNT3A)
   05205 Proteoglycans in cancer
    89780 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    89780 (WNT3A)
   05226 Gastric cancer
    89780 (WNT3A)
   05217 Basal cell carcinoma
    89780 (WNT3A)
   05224 Breast cancer
    89780 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    89780 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    89780 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    89780 (WNT3A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   89780 (WNT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 89780
NCBI-ProteinID: NP_149122
OMIM: 606359
HGNC: 15983
Ensembl: ENSG00000154342
Vega: OTTHUMG00000037593
Pharos: P56704(Tchem)
UniProt: P56704
LinkDB All DBs
Position
1q42.13
AA seq 352 aa AA seqDB search
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggccccactcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccacgacagcctggccatcttcgggccc
gtgctggacaaagctaccagggagtcggcctttgtccacgccattgcctcagccggtgtg
gcctttgcagtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccctgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

DBGET integrated database retrieval system