KEGG   Homo sapiens (human): 89853Help
Entry
89853             CDS       T01001                                 

Gene name
MVB12B, C9orf28, FAM125B
Definition
(RefSeq) multivesicular body subunit 12B
  KO
K12186  ESCRT-I complex subunit MVB12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    89853 (MVB12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89853 (MVB12B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    89853 (MVB12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2464
Motif
Other DBs
NCBI-GeneID: 89853
NCBI-ProteinID: NP_258257
HGNC: 23368
Ensembl: ENSG00000196814
Vega: OTTHUMG00000020687
Pharos: Q9H7P6(Tbio)
UniProt: Q9H7P6 A0A024R8B8
LinkDB All DBs
Structure
PDB: 

Position
9q33.3
AA seq 319 aa AA seqDB search
MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRN
RAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIK
DTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIG
ELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPRHISLTLPATFRGRNSTRTD
YEYQHSNLYAISAMDGVPFMISEKFSCVPESMQPFDLLGITIKSLAEIEKEYEYSFRTEQ
SAAARLPPSPTRCQQIPQS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagaagctgcttctgcgtgagacggagccgggacccgccgccgccgcagccaccgccg
ccgccgccccagcggggaacagaccagtccaccatgcctgaagtcaaagacctctcagaa
gccttgccagaaacgtcaatggatcccatcacgggagtcggggtggtggcttctcggaac
cgagccccgacaggctatgacgtagttgcacagacagcagatggtgtggatgctgacctc
tggaaagacggcttatttaaatccaaggttaccagatacctgtgtttcacaagatcattt
tccaaagaaaatagtcatctggggaacgtgttagtagatatgaagctcattgacatcaag
gacacactgcctgtgggcttcatcccaattcaggagacggtggacacacaggaagtggct
tttaggaagaagaggctgtgcattaaatttattccacgggattcaacggaagctgcgatt
tgtgacattcggatcatgggccggaccaagcaggccccgcctcagtacacgtttattggg
gaactgaacagcatggggatctggtatcgaatgggcagagtaccaagaaatcatgactca
tctcaacccacaacgccttcccagtcatcagctgcctccaccccagcccccaaccttccc
aggcacatctccctaacacttcctgccaccttccgaggcaggaacagcacccggacggac
tacgagtaccagcactccaatttgtatgccatatcagcaatggatggtgtgccttttatg
atttcagagaagttttcttgtgttccagaaagtatgcagccctttgatctcctgggaatc
accatcaaatctctagcagaaatcgaaaaagagtacgagtacagcttccgcacagagcag
agcgcagccgccaggctcccgcccagccccaccaggtgtcagcagatcccgcagtcctga

KEGG   Homo sapiens (human): 93343Help
Entry
93343             CDS       T01001                                 

Gene name
MVB12A, CFBP, FAM125A
Definition
(RefSeq) multivesicular body subunit 12A
  KO
K12186  ESCRT-I complex subunit MVB12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    93343 (MVB12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    93343 (MVB12A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    93343 (MVB12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2464
Motif
Other DBs
NCBI-GeneID: 93343
NCBI-ProteinID: NP_612410
HGNC: 25153
Ensembl: ENSG00000141971
Vega: OTTHUMG00000166252
Pharos: Q96EY5(Tbio)
UniProt: Q96EY5 A0A024R7L6
LinkDB All DBs
Position
19p13.11
AA seq 273 aa AA seqDB search
MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLG
SLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVF
DVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKG
GLLERTASRLGSRASTLRRNDSIYEASSLYGISAMDGVPFTLHPRFEGKSCSPLAFSAFG
DLTIKSLADIEEEYNYGFVVEKTAAARLPPSVS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggatcccgtacccgggacagactcggcgccgctggctggcctggcctggtcgtcggcc
tctgcacccccgccgcgggggttcagcgcgatctcctgcaccgtcgagggggcacccgcc
agctttggcaagagcttcgcgcagaaatctggctacttcctgtgccttagttctctgggc
agcctagagaacccgcaggagaacgtggtggccgatatccagatcgtggtggacaagagc
cccctgccgctgggcttctcccccgtctgcgaccccatggattccaaggcctctgtgtcc
aagaagaaacgcatgtgtgtgaagctgttgcccctgggagccacggacacggctgtgttt
gatgtccggctgagtgggaagaccaagacagtgcctggataccttcgaataggggacatg
ggcggctttgccatctggtgcaagaaggccaaggccccgaggccagtgcccaagccccga
ggtctcagccgggacatgcagggcctctctctggatgcagccagccagccaagtaagggc
ggcctcctggagcggacagcgtcaaggctgggctctcgggcatccactctgcggaggaat
gactccatctacgaggcctccagcctctatggcatctcagccatggatggggttcccttc
acactccacccacgatttgagggcaagagctgcagccccctggccttctctgcttttggg
gacctgaccatcaagtctctggcggacattgaggaggagtataactacggcttcgtggtg
gagaagaccgcggctgcccgcctgccccccagcgtctcatag

DBGET integrated database retrieval system